SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for LOC_Os07g17230.1|13107.m01806|protein from Oryza sativa ssp. japonica 5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os07g17230.1|13107.m01806|protein
Domain Number 1 Region: 546-798
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.03e-37
Family G proteins 0.055
Further Details:      
 
Domain Number 2 Region: 861-1084,1124-1265
Classification Level Classification E-value
Superfamily L domain-like 1.87e-32
Family Internalin LRR domain 0.072
Further Details:      
 
Domain Number 3 Region: 350-533
Classification Level Classification E-value
Superfamily RNI-like 2.82e-29
Family Cyclin A/CDK2-associated p19, Skp2 0.016
Further Details:      
 
Domain Number 4 Region: 71-160
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.84e-21
Family B3 DNA binding domain 0.0003
Further Details:      
 
Weak hits

Sequence:  LOC_Os07g17230.1|13107.m01806|protein
Domain Number - Region: 1271-1335
Classification Level Classification E-value
Superfamily L domain-like 0.085
Family Rab geranylgeranyltransferase alpha-subunit, C-terminal domain 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) LOC_Os07g17230.1|13107.m01806|protein
Sequence length 1357
Comment disease resistance protein, putative, expressed
Sequence
MEPGSSSREGEQQEPANERLTATGGGGGGGGGSPVSDQELSDGEEVSDGEYQAGDDFSGY
AVRGRGFVEKEHIFDKVVTPSDVGNLGRLVIPWQHAECYFPRDVPANEREGVVLRFEDDA
GNSWRFLYRGSSLTLGWSHFFRKNRLDAGDMVSFYRGASEATRDRLFIHSKRRMHILPTL
GYSDPQVHINRLFQLLVRVRTMVSSFGKSGSPSPPNSPLPTVQNFTYKALKDCLQDLHYY
SLLSMMGRNHKSQSTSAKIRDTIPTLDALIQLRSLSDPVFRIPAAATSHCILLCRGVLGI
MGFLCSDENMKEDHRMLQVPAFDDLNYSAQDKITRMKEQTMPSSLADPIYLLPTAIRNLL
YLDLSNCSDIVQLPPSLGSSLHMLSALNLSCCYSLRALPDSLVCLYDLQILLLSFCHNLQ
NLPVSFGDLSNLRLLDLSGCRSLRLFPSSFVNLGSLENLNLSDCIRLMGIPQNFEDLQKL
EYLNFAGCYRVDLPVYCLTNLVNLKCLTLSNHTDIKDFPYSFTDLKRHLYLSRWWKYNWV
HTQCNLKSYRCHQQRIINSLLSDGSDEGDITSEQSLTSICIFGERGTGKTELLHEIYNDQ
KILEGFHLRIWINMCDKKRLLEKIIEFTACAYCYDAPSSILEETVREELNGKRFLLVLND
ADIENQCFWTDVWKVSNVGAAGSALIVTTRSKEVASLFGAMKPYYMNPLSKEECFMVFQE
HADCGFDINNDHELTKVGWKIVEKCGGNLLCMKALSGLLWHSKTALSEIDSLVGGIVPAL
RLCYDLLPSHLKQCFKFCSLFPKDYVFVKHHIIQLWISQGFVYPEEDSQPEDTGLQYFNE
FLCRSFFQHCPFSNDHEDKFVMHELFHDLARSVSKDESFSSEEPFFSLPENICHLSLVIS
DSNTVVLTKEHRHLQSLMVVRRSATEYSSSFVPLLKILGLNDLLMKCGFLRALNLSCTTI
VDLPGSIGRMKHLRFLAMNNTKIKSLPTEIGQLNTLQTLELKDCCCLIELPESTKNLMKL
RHLDVQKEPGNIHVGMPSGLGQLTDLQTLTVFNIGDDLSHCSIRDLKNLSGLRGHVHITG
LQNITAGDDAKEANLVGKQFLQALTLEWCCSSEEMEDESDKEIANQVLQNLQPNTSIQEL
AIQNYPGNSFPNWIKDSGLCMLVSITIDNSQDCNEIPYLGDLPCLKFLFIQKMYAVENFG
QRSNSLTTDGKHAPGFPSLEILNLWEMYSLQFWNGTRYGDFPQLRGLSISRCPKLSNLPP
LISLLYLSFHCGDQLPALSEFPSLKSLKIEGFQKLKSVSFCPEMPLLQKLEISDCKELVS
IDAPLLSVSNLKVVRCPKLHFGGSWLEGCLMWEEFKR
Download sequence
Identical sequences LOC_Os07g17230.1|13107.m01806|protein 39947.LOC_Os07g17230.1 LOC_Os07g17230.1|PACid:21901745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]