SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for LOC_Os08g10330.1|13108.m01100|protein from Oryza sativa ssp. japonica 5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os08g10330.1|13108.m01100|protein
Domain Number 1 Region: 668-958
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.91e-79
Family Protein kinases, catalytic subunit 0.00013
Further Details:      
 
Domain Number 2 Region: 93-383
Classification Level Classification E-value
Superfamily L domain-like 2.72e-49
Family Polygalacturonase inhibiting protein PGIP 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) LOC_Os08g10330.1|13108.m01100|protein
Sequence length 1023
Comment SHR5-receptor-like kinase, putative, expressed
Sequence
MSCSSSSVHGFLWLMLVYASCAAVQAQQAARTDPAEVAALNTILGRWGLRASPAWNISGE
PCSGVAIDETGVDNNPNINPAIKCDCSFNAGTVCHIIRLRVFSLNVVGQIPEELQNLSYL
NNLDLRRNYLTGPLPSFIGNFSAMQYLAVSLNPLSGPLPKEIGNLRNLLSLGISSNNFTG
ELPAELGNLEKLEQMYIISSGFSGPFPSTFSKLKNLKILWASDNDLTGKIPDYFGSFPNL
QDLRFQGNSFQGPIPASLSNLTRLTSLRIGDILNGSSSLSFISNLTSLNVLILRNCKISD
NLGTVNFSKLAGLTLLDLSFNNITGHVPQSILNLDKLSFLFLGNNSLSGSLPYDKSPSLN
NLDFSYNHLSGSFPPWVTGNNLQLNLVANDFILDSTNNSILPSGLNCLQQDTPCFRGSPE
YYSFAVDCGSNKSTRGSDNTLYETDAQNIGAASYYVSDNARWGVSSVGKFNEASNGSYAI
YSPQQFQSALNSELFQTARMSPSSLRYYGIGLENGNYTVSLEFAEFVYPNSLTSNSIGRR
VFDIYVQGELKEKNFNIRKMAGGKSLIAVNKRYTATVSKNFLEIHLFWAGKGTCCIPTQG
HYGPTISALSVTPNFIPTVQNGVPKKKSKAGTISGVVIGASFFGLAVLVGLFMLLKKRRR
TSQRKEELYNMVGRRNVFSNAELKLATENFGSQNILGEGGYGPVYKGILTDGRVVAVKQL
SQSSQQGKSQFVTEVATISSVQHRNLVKLYGCCIDSNTPLLVYEYLENGSLDQALFGDGR
FNLGWSTRFEIILGIARGLSYLHEEANVRIVHRDIKASNILLDPDLTPKISDFGLAKLYD
EKKTHVNTKVAGTFGYLAPEYAMRGHLTEKVDVFSFGVVALETVAGRSNTDYSLVEDKKY
LFEWAWGLYEREQALGIVDPRLEEINEEEVLRVIRMSFLCTQGSPHQRPPMSRVVAMLTG
DIPVSDVVAKPNYIIELQLRGRNSSHVTTGYSGSTADELSGQRETSPLTPSLEINREIID
DGR
Download sequence
Identical sequences Q6ZKW6
LOC_Os08g10330.1|13108.m01100|protein 39947.LOC_Os08g10330.1 LOC_Os08g10330.1|PACid:21890252 XP_015648141.1.37577

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]