SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for LOC_Os08g17990.1|13108.m01918|protein from Oryza sativa ssp. japonica 5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os08g17990.1|13108.m01918|protein
Domain Number 1 Region: 801-902,932-1116
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 0.00000000000000125
Family Reverse transcriptase 0.091
Further Details:      
 
Domain Number 2 Region: 462-555
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.000000000000044
Family Retroviral integrase, catalytic domain 0.014
Further Details:      
 
Domain Number 3 Region: 1456-1507
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000314
Family B3 DNA binding domain 0.009
Further Details:      
 
Weak hits

Sequence:  LOC_Os08g17990.1|13108.m01918|protein
Domain Number - Region: 229-264
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000968
Family Retrovirus zinc finger-like domains 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) LOC_Os08g17990.1|13108.m01918|protein
Sequence length 1661
Comment retrotransposon protein, putative, unclassified
Sequence
MASSSSVPAPSLHGQSVSEKLSKSNHVLWKAQVLATLRGAQMAGFLDGTAVAPATTLVVA
SKDKDGKEVTEKVANPAYATWVAQEQQVLSYLLSSLSRDILVQVATLTKASEVWEAIDAI
FSSQSRARVLNTRMALSTTKKGNKSVAEYVSKMKSLADEIATTGKPLDEEDLVSYILAGL
DYDYNPLVSSVATRVEPLMSSANSMLRGGRGGGGGRDGRGRGRGGGNGGRGGFGRGNDNK
NNGNRPTCQLCGKIGHTVIKCWKRFDTSFTGEEKVAGAATSYGVDTNWYLDTGATDHITG
ELEKLSVKEKYNGNDQVHTANGTGMDINCVGHTTIRSSNRNLLLRNILHIPTAQKNLVYV
HHFLRDNHAFMETYPHVFFIKDLATRKLLLQGRCRGGLYPLPSSHSTSMNKQAHSVVKPS
TARWHHRLGHPSFAVVNRVISQNNLPGKCHQLPFQKSTSVSAGPLDLVYSDVWGPAPNSV
GNKSYYNLVERLLERKIKVVQTDWGGEYQRLNTFFQRIGIEHHVSCPHTHQQNGAAERKH
RHIVEVYPFASLHTNAGAKLRAEILLLPSHLQPSSSFGSGGELLVEPLVNNPNPDTNQND
EISAAVINSGDGDANAAQNFSFKGAETRSNGQYFMQDAQPASSAQGSMDPSHQQSPSCQQ
AADARQPTAGAAGADLHEAASPVGEGQMQELEPELSSSHGSGTPTGEPAPGSSAATNSGD
STQDPETSTEAFAVPEETAVTAPVGPVTRAQRGIRKRKEYTDGTVRYGFLIETGEPVNLQ
EAVSNRNWKVAMDKEFTALMHNKTWHLVPPVQEKNVIDCKWVYKIKRKSDGSIDRYKARL
VAKGFKQRYGIDYKDTFSPATKALLKDLEKDFALKDLGDLHYFLGIEVKKNSQGLVLSQE
RYATEVLKRVGMAKCKPTNTPLSTSEKLSSTQGAVLGQNDATQYRSIVGALQYLTLTRPD
ISFSVNKVCQYLQQPTVDHWSAVKRILRYIQGTVSLGLKINRSASTLISAFFDADWAGCV
DDRRSTGGFAVFLGSNLVSWSARKQATVSRSSTEAEYKALANATAEVIWIRKLLDEIGIK
QPNAARLWCDNLGATYLSANPVFHARTKHIEIDFHFVREQVAQKLLDIRFISTDDQVADG
FTKALPVRRLEMFKNNLNLGRPEAKGIALIHFYRIYLIRLLYLCLAFSTLSLSHRLPLYT
WNPDDSKFWQVRDTMMSSRDTLPPPDLRHGGGGASDQTNSAVPVSETPMEDGGGAPAAAG
SSNTAAPPQPPRLDGPTLERELRRCNIKLGKQKVSGEASTATTEPPRKKLMHDGIRAAAA
AAPPPRSPPTRRIISYMVTAAAPPERKKTAADDRFRNLGTCSAQLRRRLSELDATEPEFV
CEKTLRMSDVHRNQNRLLFSCKRKEDLDQCPITHLFTDKETQIVHKKDEIAVEKKKKKKI
KKDEKKKEIKKEEEKQIREKLGLKVTVFDQGGNEYGMTCRYLESNGGYRFIEGWGKFVET
NGMAISDSQRWTRDVVVKLLAFRSRRLARGAEQSDHPDGPIGFIVLHHENGSRGRGDNDN
DNEEEEEEEYQGKAPPANPKKEKSNGKEEHVVRASTSSSSSSAEAAVGVVAPMHEVSAAP
RNMLEEDACLGMVKLWSDTGSSSSSSKYNGPESSEEKRKKD
Download sequence
Identical sequences 39947.LOC_Os08g17990.1 LOC_Os08g17990.1|13108.m01918|protein LOC_Os08g17990.1|PACid:21890125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]