SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for LOC_Os09g21360.1|13109.m02044|protein from Oryza sativa ssp. japonica 5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os09g21360.1|13109.m02044|protein
Domain Number 1 Region: 165-222
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000863
Family B3 DNA binding domain 0.013
Further Details:      
 
Weak hits

Sequence:  LOC_Os09g21360.1|13109.m02044|protein
Domain Number - Region: 26-86
Classification Level Classification E-value
Superfamily PLP-dependent transferases 0.00324
Family GABA-aminotransferase-like 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) LOC_Os09g21360.1|13109.m02044|protein
Sequence length 222
Comment expressed protein
Sequence
MTGILIYLHDNRCAISLGQSEVIEIKLCLLRILHMFSMDGDFGPLLELIKLHRMYGLLLV
MDVPWTVGDHCDVGVIGLTKCSGTHGLLPCFDTFLLVSIQRETICVHPLDFMIWPQVKGK
CTNLATKATPTRIAIDGDRCSIDPSSPVCYSHFTATIMSSAVFASMRLNATNQSYLPVPI
TLATAYKMQHGDNLKLKTSHGLKIKIKIKEVASTLYMTTGWR
Download sequence
Identical sequences LOC_Os09g21360.1|13109.m02044|protein 39947.LOC_Os09g21360.1 LOC_Os09g21360.1|PACid:21924985

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]