SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for LOC_Os11g04600.1|13111.m00420|protein from Oryza sativa ssp. japonica 5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os11g04600.1|13111.m00420|protein
Domain Number 1 Region: 298-380
Classification Level Classification E-value
Superfamily Ankyrin repeat 7.93e-19
Family Ankyrin repeat 0.001
Further Details:      
 
Domain Number 2 Region: 9-55,94-127,186-213
Classification Level Classification E-value
Superfamily POZ domain 2.09e-17
Family BTB/POZ domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) LOC_Os11g04600.1|13111.m00420|protein
Sequence length 494
Comment BTBA5 - Bric-a-Brac,Tramtrack, Broad Complex BTB domain with Ankyrin repeat region, expressed
Sequence
MSSEDSLKSLSLDYLSLLINGQAFSDVAFSVEGRLVHAHRCVLAARSLFFRKLFCGLDPN
HQPPPPPPPLNWPMAGGGGGGSGGGGRGGAGGGGGAPATPELVIPVSSIRYEVLVLVLQF
LYSGQASVAAPKSGPLPGCGARGCWHTRCGAAVDLALDTLAAARSFGVEQLALLVQKQLE
SMVKEASVDDVMKVLMASRKFEMQELWATCSHLVARSGLSADLLAKHLPIDVVAKIEEIR
AKSPLAAVAAPRSPFLTHHYLPMNPASSAADRDNKIRRMRRALDAADIELVKLMVMGEGL
DLDDALAVHYAVQHCNRDVVKALLELGAADVNSRAGPTGKTALHLAAEMVSPDMVSVLLD
HHADPNSRTLDGVTPLDVLRSLTSEFLFKGAVPGLTHIEPNKLRLCLELVQSAVMVTTRD
DGAPVTGGAEAGGSDGGNFPRSDADDSLVSLTMNSTLMYQGQEMAAAVAAGEGRKSNNGR
GSPPPAMYFPNGFA
Download sequence
Identical sequences Q2RAQ5
39947.LOC_Os11g04600.1 LOC_Os11g04600.1|PACid:21945737 LOC_Os11g04600.1|13111.m00420|protein XP_015616658.1.37577

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]