SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for LOC_Os12g07990.1|13112.m00842|protein from Oryza sativa ssp. japonica 5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os12g07990.1|13112.m00842|protein
Domain Number 1 Region: 343-656
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.37e-67
Family Protein kinases, catalytic subunit 0.00017
Further Details:      
 
Domain Number 2 Region: 23-139
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 0.0000000653
Family Universal stress protein-like 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) LOC_Os12g07990.1|13112.m00842|protein
Sequence length 738
Comment protein kinase family protein, putative
Sequence
MSRRAPPTMLALPAPPRLGWGGRTVVVGVRDDAEGRELLTWALAMVAFAGDRVVALHVAT
PAAAAGADQEGAMRMAARRIRATESLAALLRAYDGFCDLNQISLELRICHGSSIKKALVN
EASSYGAAHLILGVTNNSRSHLRPSSSPSSSSAAVAKYCAKRVPPSCSVLAVGNGRVVYR
RDAAQQQLNQCISPLVETPRRIYRKIYRKLVRAATTITREKSQDDAAIAGGGRHLRRNIS
TPTSAPVSPVVAFTPRQAEVAAGWPLLSPDLKSALPEWTEMSVARWAMQLPSRCPAPSPL
NPRNNSGDQATSPAITASETPSPATDEAAEQVAQELASLRNKYSSKYTMFSYSELARITS
NFSPDRIIGKGGASEVYKGCCDDGKEVAVKVLKSSDKVMEELVSEMEIVSSVRHGNAMPL
TGFCLDGGGGAAKIMLVYDYMARGSLEEILHGEKEGKDLFGWPERFKVAAGVARALVYLH
GGDGDGRPVIHRDVKSSNILVSEDFQPKLCDFGLALWAAEAASPVTGDDVAGTFGFVAAA
ASSHLLEEFKYLAPEYFMHGKVSDKIDVYAFGVVLLELVSGRKPVSSGGGKGKESLVMWA
NTIIQGGKLTDLVDPSLPTDGSGVAGEVERMTLAAALCIRRSPQRRPSIANVLKLLDGDG
DAVRWVRSQAGLSAGDDTDDGDGASPEKKDIQSYINLALLDVVDDSASVSSGGGDFTAAN
VSLEEYTKGRWSRSSSFD
Download sequence
Identical sequences Q2QWW5
LOC_Os12g07990.1|PACid:21935604 LOC_Os12g07990.1|13112.m00842|protein 39947.LOC_Os12g07990.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]