SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for LOC_Os12g17140.1|13112.m01816|protein from Oryza sativa ssp. japonica 5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os12g17140.1|13112.m01816|protein
Domain Number 1 Region: 252-321
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000275
Family B3 DNA binding domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) LOC_Os12g17140.1|13112.m01816|protein
Sequence length 336
Comment mla1, putative
Sequence
MAGAIVSASVGVLNPLLTKLSSLIEGEYKLLKSVKKDIIFLRNELSSISVLLEHLSNKED
KLDGPTMEWRNNMLELAYDIEDCIDLFIHKLSCGDANANFVRKIGSKIKKLWGKHQITEC
IQELKNRVMEEDQRRKRYQIDDFISEPSMVEIDPRLLALYEEVERLVGIDGPREKIVKWI
MHKDWSSEQRKVVSIVGWVGSSSMSDATAAEDAEDCSATSLMPESKKEEGKGEMGGVVRS
FSTQFAEFEAFSIPFSEQYINEHLPIEDLLVTVVGSTVSYPMRLMKSKDKQATFTTGWNK
LVGDKLFELCDVCVFMFSENDAELTLSLELLNNCEG
Download sequence
Identical sequences Q2QU83
LOC_Os12g17140.1|13112.m01816|protein 39947.LOC_Os12g17140.1 LOC_Os12g17140.1|PACid:21938119

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]