SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Ostta4|29963|0000690001 from Ostreococcus tauri

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Ostta4|29963|0000690001
Domain Number 1 Region: 13-148
Classification Level Classification E-value
Superfamily Hsp33 domain 1.44e-33
Family Hsp33 domain 0.0000228
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Ostta4|29963|0000690001
Sequence length 161
Sequence
MSCSTGLVMSDFDKLHRFLFTQANVRGELVRLDESLKQIVHSYEYPVQIQTLLSEMAAAT
SLLTATLKFKGEISLQIQSKGPVSYAVLNATHEQTLRGVARWDETLETLPETFSELLSQA
VLVITITPDEGERYQGVVALDKPSLAESSDQRAPNDRHERP
Download sequence
Identical sequences jgi|Ostta4|29963|0000690001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]