SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Ostta4|32238|0400010184 from Ostreococcus tauri

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Ostta4|32238|0400010184
Domain Number 1 Region: 66-178
Classification Level Classification E-value
Superfamily EF-hand 2.41e-18
Family Calmodulin-like 0.015
Further Details:      
 
Weak hits

Sequence:  jgi|Ostta4|32238|0400010184
Domain Number - Region: 408-454
Classification Level Classification E-value
Superfamily MgtE N-terminal domain-like 0.00112
Family MgtE N-terminal domain-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Ostta4|32238|0400010184
Sequence length 485
Sequence
MAEEVPPGDPPVEQVVDEPADEPADATPRTYLGVAIDFARALYKNCVPKRAILTPFEQGV
KASRLLRRTRKDFARFDADGSGGIDRDELCDVLEIDRRGTTSRAVLDFFDADGDGKINFE
EFVSTLGTLGAVVDNMRRCKENRKENIPREVCFVFTVMDFDGDGRVDRGDFAQLLWEYER
RKERSFGRLKSVPVANFSAIDSSLEVTATERYIADQRAERREFLRPVRAFVKSATLYLSR
QCPEAMTLQDVDKVYTEFKPLFEATIALHKQLRNISERCAKLIRTLYNGIDDIEELHRQM
CDRAIAMRAKREENKGDWDWAKGLQRSSKHTSAREEHVKEERQVLAEVAQIGRLLRGERV
VKSGTEEEREFLSAFSFRRDGSVHRAESRRLRGPRASGRGSSSIETARMRARQLAHQPPR
EAAKVLSELGVTAQKDVIHRLSRDNAAKIIVEMGQLQQDVLLCHFKELQESVMRIKIARV
EDFGR
Download sequence
Identical sequences Q01B65
XP_003078702.1.19543 70448.Q01B65 jgi|Ostta4|32238|0400010184

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]