SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Ostta4|35190|1000010210 from Ostreococcus tauri

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Ostta4|35190|1000010210
Domain Number 1 Region: 779-868
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000634
Family Filamin repeat (rod domain) 0.0024
Further Details:      
 
Domain Number 2 Region: 4278-4389
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000734
Family Filamin repeat (rod domain) 0.0051
Further Details:      
 
Domain Number 3 Region: 442-546
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000153
Family Filamin repeat (rod domain) 0.0059
Further Details:      
 
Domain Number 4 Region: 4489-4591
Classification Level Classification E-value
Superfamily E set domains 0.00000000000003
Family Filamin repeat (rod domain) 0.0037
Further Details:      
 
Domain Number 5 Region: 1873-1973
Classification Level Classification E-value
Superfamily E set domains 0.000000000000654
Family Filamin repeat (rod domain) 0.005
Further Details:      
 
Domain Number 6 Region: 3020-3108
Classification Level Classification E-value
Superfamily E set domains 0.00000000000934
Family Filamin repeat (rod domain) 0.014
Further Details:      
 
Domain Number 7 Region: 2087-2170
Classification Level Classification E-value
Superfamily E set domains 0.0000000000227
Family Filamin repeat (rod domain) 0.0038
Further Details:      
 
Domain Number 8 Region: 886-984
Classification Level Classification E-value
Superfamily E set domains 0.00000000016
Family Filamin repeat (rod domain) 0.0065
Further Details:      
 
Domain Number 9 Region: 2690-2772
Classification Level Classification E-value
Superfamily E set domains 0.000000000607
Family Filamin repeat (rod domain) 0.0078
Further Details:      
 
Domain Number 10 Region: 1784-1883
Classification Level Classification E-value
Superfamily E set domains 0.00000000127
Family Filamin repeat (rod domain) 0.015
Further Details:      
 
Domain Number 11 Region: 3298-3398
Classification Level Classification E-value
Superfamily MgtE N-terminal domain-like 0.00000000523
Family MgtE N-terminal domain-like 0.0084
Further Details:      
 
Domain Number 12 Region: 267-346
Classification Level Classification E-value
Superfamily E set domains 0.0000000054
Family Filamin repeat (rod domain) 0.013
Further Details:      
 
Domain Number 13 Region: 1975-2081
Classification Level Classification E-value
Superfamily E set domains 0.00000000614
Family Filamin repeat (rod domain) 0.0095
Further Details:      
 
Domain Number 14 Region: 992-1075
Classification Level Classification E-value
Superfamily MgtE N-terminal domain-like 0.00000000693
Family MgtE N-terminal domain-like 0.0075
Further Details:      
 
Domain Number 15 Region: 2474-2557
Classification Level Classification E-value
Superfamily E set domains 0.00000000734
Family Filamin repeat (rod domain) 0.005
Further Details:      
 
Domain Number 16 Region: 1077-1175
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 0.0000000105
Family Serine carboxypeptidase-like 0.0099
Further Details:      
 
Domain Number 17 Region: 3562-3663
Classification Level Classification E-value
Superfamily MgtE N-terminal domain-like 0.0000000698
Family MgtE N-terminal domain-like 0.0083
Further Details:      
 
Domain Number 18 Region: 559-664
Classification Level Classification E-value
Superfamily E set domains 0.0000001
Family Filamin repeat (rod domain) 0.0079
Further Details:      
 
Domain Number 19 Region: 4607-4709
Classification Level Classification E-value
Superfamily E set domains 0.00000016
Family Filamin repeat (rod domain) 0.011
Further Details:      
 
Domain Number 20 Region: 4416-4518
Classification Level Classification E-value
Superfamily E set domains 0.00000024
Family Filamin repeat (rod domain) 0.011
Further Details:      
 
Domain Number 21 Region: 3125-3224
Classification Level Classification E-value
Superfamily E set domains 0.0000005
Family Filamin repeat (rod domain) 0.011
Further Details:      
 
Domain Number 22 Region: 2184-2272
Classification Level Classification E-value
Superfamily E set domains 0.0000011
Family Filamin repeat (rod domain) 0.015
Further Details:      
 
Domain Number 23 Region: 2611-2678
Classification Level Classification E-value
Superfamily E set domains 0.00000414
Family Filamin repeat (rod domain) 0.013
Further Details:      
 
Domain Number 24 Region: 374-461
Classification Level Classification E-value
Superfamily E set domains 0.0000231
Family Filamin repeat (rod domain) 0.0091
Further Details:      
 
Domain Number 25 Region: 1430-1541
Classification Level Classification E-value
Superfamily MgtE N-terminal domain-like 0.0000637
Family MgtE N-terminal domain-like 0.012
Further Details:      
 
Domain Number 26 Region: 1553-1635
Classification Level Classification E-value
Superfamily E set domains 0.00007
Family Filamin repeat (rod domain) 0.028
Further Details:      
 
Domain Number 27 Region: 1651-1745
Classification Level Classification E-value
Superfamily E set domains 0.0000737
Family Filamin repeat (rod domain) 0.014
Further Details:      
 
Weak hits

Sequence:  jgi|Ostta4|35190|1000010210
Domain Number - Region: 3801-3883
Classification Level Classification E-value
Superfamily MgtE N-terminal domain-like 0.000262
Family MgtE N-terminal domain-like 0.011
Further Details:      
 
Domain Number - Region: 4067-4164
Classification Level Classification E-value
Superfamily E set domains 0.000387
Family Filamin repeat (rod domain) 0.016
Further Details:      
 
Domain Number - Region: 4214-4309
Classification Level Classification E-value
Superfamily E set domains 0.00173
Family Filamin repeat (rod domain) 0.051
Further Details:      
 
Domain Number - Region: 4023-4058
Classification Level Classification E-value
Superfamily E set domains 0.0048
Family Filamin repeat (rod domain) 0.026
Further Details:      
 
Domain Number - Region: 3514-3579
Classification Level Classification E-value
Superfamily MgtE N-terminal domain-like 0.00575
Family MgtE N-terminal domain-like 0.0061
Further Details:      
 
Domain Number - Region: 693-790
Classification Level Classification E-value
Superfamily E set domains 0.0771
Family Filamin repeat (rod domain) 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Ostta4|35190|1000010210
Sequence length 4964
Sequence
MSVESGAGADVGRSRFKSLRGWKVDKYQFDVRAHSAYNVLPGTARLRLVWRRGSKREHTS
AVKVTRGEATWDEPLAMTCSMFVNPKTGMYESKPAMFVLQVVDESGREQKKYAEATVDLR
EFALCPGREVSRTVPLRQGAVTMLTHLQFSVTATPLEENVVLSEVSSTLSVADLADVGEA
AATSVALPASVTQVLATTVPGQYDDEAYFDEQISMKENAAADGGVDEDFSYFDSRLAAQV
IDDEEDLPPPTDDELLSGVDVEEGIVPGVKMLRLIVGKKCKIFVRGQDNFGNSRTTGGDN
VEGILIGPSGQRGLVSTKDHGDGSYLLEFTCMQQGVWTLRTRMNGHLSDERHKLIVTYGP
LVASDVRLQLPQPPFRCGGYTDMQIVVEHPEDGRILTGAEAFNVRLVSPAGVSMGVALDV
KAGTTAAVARINWPEVGEHQIDVRLDGEPLKGSPMKVIVVPEELCLAACQLQGPGVHKCT
AGLRAAFIVEAHDSRGNRLLSGGAALSIGVRTSTNESYTGEIIDFGNGTYEVSYTVRVAG
FYEMTLECLGEELVIKGICEPGKAVVAGCELIGDAGLDLEVGSSGRYSIVRHDAYGNRVP
TRQGQIKFKVVADGPGPATCSIIERADGVSDVDVSTSVSGRYYVQVTSHDQEPIPGSPFE
VVAYPGPASSETSVTTVFGAQLASSDSDVLVAVAGEEVSLAVAPRDIYGNATIFSKSATV
TAIATGGGMTIPFEERQGDRQEVALFASFRMAGSYLLSAKVGDNVLDGYPRIITVVSAAT
EPQKCVLFGEALQGVRCNRITTLTIHASDRFGNLRSTGGDVVDVTLSSPDGKYVVAAKVD
DHADGTYGAKFKLERPGTWEINLVINGRGGRTQVNEVTSFFAGVKASECVFSGMGSDGVE
GVLCFKPSKIVIEPADFEANARLMSGQEAVGVRILTPSGGISSVDLKFEKGKYTGSYTWT
QPGQHTVSVSLDQEAVVGSPFTVEAMTALPQIAEIENMSEGEVAELLPKLSGDGASQALQ
SVAPDKAARILEESSPEAVVRMTANVMVGNVAEILSCMPPDRSVETLNAMSDERAMEGDN
PVRFNLRGVAIGNGLTEPAIQYGAYADYSLGNDIVDAKAAAEAMKAYPACRKAIKACYRG
DAGEKSNRATCIRALNACQIIPETLLENAASRFDAGLTSQPPLKSTSWILAKFFRQATPE
HLAGCIFALVEDSARSVTSQTNSRPVAQMKEDGEIEWGDGSKSRVSQDGAHIVHSDGTKA
TLSDDGVIIDTDGQVLRLRDDGLITSDGSIVDENGEIIAAPSGALHFYRALTAEQRADVM
RELLAFTPPGTSGKLLIELTMTEIRDLLAPMGSDYVAKALVEIARSSPLIAGRSASVLSH
TEAASAISILVNPGSSQRCTEPFMGSFLEALTPQILRNVQPPTAVGGALAEHLSPTSAAQ
VLHKMEPMDVSRILEGMSPAEVSEVIEASVAIQEQTGKKLSDTPFTAALVPYVSAMENTQ
AAALLESLPTDMAVGIMMCTPDERAHEIMEHTRRRDLKDRVANKSLIHLDACTISNIRGA
IVGEQSSFILESRERGGNKIPFGGAALSVSTKLASAPGPGVELGAVYDRGNGEYLVQFSS
TMAGEVAVIVESSGQSRSWKVNVEASDVVVGKCTVDKQGLQSWTAGSPGKLLLVLRDRFG
NFAHSTKSILEFECRASGPGGVIVERNMLDNGKIEFVLNTTVTGIYKVTVVCLDTKENLS
GCPFDARMGTDVLSQAGCTAMLQSVTSLTKGPGAKAAAHGACAAMAGEEVTCIVEARDRY
GNSSTFAGENVSVSAYGPAHMPADRPFEISDVRTGRIALKAIFPRSGSYTVAVTVDGIPI
ATSPLILHVFPGTCETSRAILRGDALNGIVASKITSLLVQTEDKYGNHCHVGGDRVNLSM
SGPNGLKINALDVKDNEDGTYSFSFIIPQSGRWTIQAVVNGRIAKESTTEVIVMYGPLHA
AACVLKSGPGMKRTETCGSQRDIYVQALEYDANGRGMSGQEAIAMHLITPSGSTHTLPVV
FAERGSRYKASLRWWEVGRHEIVAAIGGEPVVGSPFVVEVEAQDVSLPMCRLSGPGLQGA
IAGERATILIESRDERGNRLFNGGAQMGIAVRSGGETLRGKVQDCGDGTYEASYIVERAG
PFELSLFLGTEAATYRALCKPGRVDYAKCRVDGVTNGAWTAGEQLVLTVTRMDRFGNRIS
RREGLAPFYGKAIGPGDVTCQSLELGNGTAEMKFYGTTAGLYQIGIYVADTPMIPYANEE
SAALMENSQLMLEESKLESKKSESKVTSGKRDDVLAGPIISMDEGQHNEASQNVALPKMM
AVNGIEMVPLPNGLFEMNLAPTVAMPNCCDLEVIGGTRADNAWVAPAGDEVIVRVIAKDR
YGNATHWEEGQTITVEALGPEFLSFVPHGTTSLQNEFVAKMIRAGTFELRVLCDALPVCW
RPIQIIAGFTFAPRSILSMDGLKDVKTGNIVRLTLRTVDMYANLRLSGGDTIQLALQGPN
KAFARQVSVTDHQDGTYALEFQVTAAGKWVLNTRINSVLHVEGGISFNVAFGTLTAEEAV
VTFDPPIPSNGTVECGQGNNLLLHGLGWERNNRVMTGLEAVSVRLTHPSGSQEAVPVTLA
KDNKSYAAKIRWLHPGSHSLTIMLDGIPVPGTPIRVVAEGKRVALIASALIGEGATRCVA
GEEARFMLYARDYSGNQINKGGADISVSCRVPGAEPILGSVIDNGDGSFECSYSTTVAGD
VELILSLNDGSIQTKRVVNIKCEAAECEINECRVDAAKMMLLWHAGEAGLIRIQRRDKYG
NPTTKYTIGGLNRFAAEVVGPGWADCEALELGDGSCELRLVAQSSGSYDISIIALAIDEE
TMTPLDVPSVELTSFSALVTSQETSPSSCVARMTLINDGRENTLADIDADITLPSTIMAG
DAIAMHVLARDFHGNPTSWLGGERIAVHARGPVEVPFTPTDVVGSFKATIMAAGAYSVAA
FVSDCACSGWPRLLQVVAGPCNPDKCTISGDALGQCSTATPISLLLQAMDEYGNPRSLGG
DFIEAILVNYDEGTVVTSVIDNSDGTYTISFELDAPIQHNLWISANGLREKQSRYSLMPS
LGALSAADCVISGIGGQRLVLADKSTLCVQPANPSRVMSGKESVVISVRLPSEISFNLPL
KFEPDTRHFTCPLLWVEVGDHHVTVTLAGEPVPGCPFMIRVRDPDEEFEEIEGEDTTNDM
AMIPADNSFGFVYTNDKTTAAVSRAALPETSENDPGDEEEEDVFTFGTPLNPPPPQQVDS
TVAVIRKLELEDAGDALSDMRPEVAAAVLQRLNPSKAACAAAMMSPSELRAAVTSMKEAS
VISMIVDAPPAARASIIEALPPEAAAQLMNNMDPRTASLCVSKLIETSVAAAIMAKMKPS
HAVQVLQFIMPDLQKELFMEFDTLSLCALITAAYNPDASPSVKKAVQVNSDTISTVFTTD
XXXXXXXXAPVVKVKVPKHKWGGTGLKPSKTASDRAARSLSGMAPKVSAQALADMRPGAA
GAVMAAMDSERVSSIIAVMDRDVMASSIASMEAEDALRVVSGVSPSARMMVIEALPVSAA
GSLLSMLPVEDAADALRSMEANAACDAISVIPSKNAASMLLQLPDDLTSTYLLALPPSTV
APILTQLCESEEGMQTASRSLQMLSEQNVSKTTVHLAGVIERDPRSSARIAAELSPEIRA
EMFGLFSAKHAGKLLQYSGPKASAAMTSAAISAGTSPAVAAMAFESLARLGVWPPSVDVP
RSGVKVRGPLADVLLETFEIDTANGAKILTALDPEVSASAVGALMPATAGSLVSAMPDPK
AAALLLESMPPAKRAAMIMKMRPQPAADTASNMPTESVAAVMTTLYATMDPATISIANDI
IVLMDPFKAGSVVAALDDNHAVRVMSGVPPLVAAAMVSSGGLPSDKAGTYLDRVKLDHAE
LVLAALPPSLADEAVQKVSSKELKTKTASRTVVHLTSSLVSGPGCEECMGKGLQIWSSNV
TYGAPVQVQDMMNGTYEFTYTVDKAGEYDAVITSAGQERVVKIKCKPAALDPSRCEVEQP
VVDAIWKAGEVFTLKVHCRDQYGNDVVPPKHGDAGVDVALLADGEGPSVVEAEVISDPSG
TGALVKFRATEVGKYTLRVFAADVSRQWWGGVQRECITGAPLSLVLSPTTVDPARSSVQL
SGIRERGANMLLGLAGRQIAIVVFARDRFNNEAEFEHERVRVDAVGVANIVFSVASKESG
QMMFTGALQRAGTYSLRVLVSGKPVHGFPRNLQIVAAQTDPRFCTIRGDALSNVIAGEVT
HLLINAADRYQNVCLEGGDRLTARLLGPAGSIDADISDFGDGTYRMAFVVPRAGEWKVYL
AVNGVENTKSATSFIAKQGGLTAKQLMLVPADKRDEYTAGDESEFYIQAIDYESGGLHVN
GNEAICLRLIAPSGLATIVSLRLSKDKARYSAHIIWPEVGAHSLIAALNGEPIVGSPLSA
VVKPAQVHASSCKITGVGSTRAVAGERASFTIEARDARGNRMTRGGAILNAVVQTALSPN
PAKASILDQGDGTYACSYTISKAGPFSITLTAHHTSTTLSAVCAPGAVDPAFCRIDAGEV
KSLEAGQSGKIRVVRSDRFGNLIPATSELTPFRVEVSGVGPADVETVEAGDGSAEIRFEA
RAVGRYTVYIWSGFKREPVLGSPCEVFVAPSQAVASSCKAQLDGAQLAAQGVYNAQAGSI
LTVHMKPHDRFGNPSAWKSWQTLNVHASGAEDIYFTEIDDDSTTSARGVFRAKFSKAGAY
VVWITVGGQTIVGWPRVVQISAGTTDAKVSSLRPESDTMALATELVRHGGNDTSLIDALG
RQSVDVDKLRGEMVALRAKLASYERSAHDGRQRGVTQTSASVPAPVTIEEVEKANAKTIK
LNVGETDSENETVGLEDDEFGSAHEDEFDEDEDEFKDPEQFGVK
Download sequence
Identical sequences jgi|Ostta4|35190|1000010210

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]