SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15645724|ref|NP_207901.1| from Helicobacter pylori 26695

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15645724|ref|NP_207901.1|
Domain Number 1 Region: 11-257
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.55e-67
Family PFOR Pyr module 0.00012
Further Details:      
 
Domain Number 2 Region: 258-403
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 1.19e-31
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15645724|ref|NP_207901.1|
Sequence length 407
Comment pyruvate flavodoxin oxidoreductase subunit alpha [Helicobacter pylori 26695]
Sequence
MAKSIELQEIEVWDGNTASSNALRQAQIDVIAAYPITPSTPIVQNYGSFKDNGYVDGEFV
LVESEHAAMSACVGAAAAGGRVSTATSSQGLALMVEVLYQASGMRLPIVLNLVNRALAAP
LNIHGDHSDMYLSRDSGWISLCTCNPQEAYDFTLMAFRIAEHQKVRVPTIVNQDGFLCSH
TVQNVRPLSDAVAYQFVGEYQTKHSLLDFDKPVSYGAQAEEEWHYEHKAQLHHAIMSASS
VIEEVFNDFAKLTGRQYHLTKTFQLEDAEIAIFALGTTYESAIVAAKEMRKKGIKAGVAT
IHSLRPFPYERLGQDLKNLKALAILDKSSPAGTMGAMFNEVTSAVYQTQGTKHPVVSNYI
YGLGERDMTIAHLCEIFEEINEDALKGTLTHPTQQFVGLHGPKMSFF
Download sequence
Identical sequences A0A246LSE3 O25738
85962.HP1110 gi|410024337|ref|YP_006893590.1| gi|410502103|ref|YP_006936630.1| gi|15645724|ref|NP_207901.1| gi|15645724|ref|NP_207901.1| NP_207901.1.64343 WP_001129867.1.100370 WP_001129867.1.12929 WP_001129867.1.14785 WP_001129867.1.15441 WP_001129867.1.15770 WP_001129867.1.16964 WP_001129867.1.18045 WP_001129867.1.19132 WP_001129867.1.21161 WP_001129867.1.21640 WP_001129867.1.23156 WP_001129867.1.23346 WP_001129867.1.26233 WP_001129867.1.26656 WP_001129867.1.27034 WP_001129867.1.29892 WP_001129867.1.30129 WP_001129867.1.32874 WP_001129867.1.32920 WP_001129867.1.32991 WP_001129867.1.34734 WP_001129867.1.34950 WP_001129867.1.37759 WP_001129867.1.3847 WP_001129867.1.3935 WP_001129867.1.45128 WP_001129867.1.45388 WP_001129867.1.45788 WP_001129867.1.46484 WP_001129867.1.47666 WP_001129867.1.51993 WP_001129867.1.53728 WP_001129867.1.56818 WP_001129867.1.5696 WP_001129867.1.58727 WP_001129867.1.61092 WP_001129867.1.63400 WP_001129867.1.64394 WP_001129867.1.65101 WP_001129867.1.65885 WP_001129867.1.66907 WP_001129867.1.6783 WP_001129867.1.71453 WP_001129867.1.71693 WP_001129867.1.73531 WP_001129867.1.74411 WP_001129867.1.7512 WP_001129867.1.76964 WP_001129867.1.77110 WP_001129867.1.77453 WP_001129867.1.78022 WP_001129867.1.78855 WP_001129867.1.79031 WP_001129867.1.79522 WP_001129867.1.81922 WP_001129867.1.84468 WP_001129867.1.85386 WP_001129867.1.85662 WP_001129867.1.85747 WP_001129867.1.87485 WP_001129867.1.88001 WP_001129867.1.88687 WP_001129867.1.8903 WP_001129867.1.94773 WP_001129867.1.95955 WP_001129867.1.97942 WP_001129867.1.98792 WP_001129867.1.98910 WP_001129867.1.990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]