SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Monbr1|13108|fgenesh1_pg.scaffold_74000002 from Monosiga brevicollis

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Monbr1|13108|fgenesh1_pg.scaffold_74000002
Domain Number - Region: 171-211
Classification Level Classification E-value
Superfamily FliG 0.0144
Family FliG 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Monbr1|13108|fgenesh1_pg.scaffold_74000002
Sequence length 467
Sequence
MALEELPEIVKSIRRQSERWPQYDGHDTMKLIELREVINAVCDSYEVPYLPELKSLEEED
LQAAAIEEKHGPGPKDNVKKLKEINNVIIVALSTCLTGTARLVLSGLRKEIKSGHGRGMI
LHDWIDRTDIDLEALESVFAQAEADLITTKLQSQNDLSNYRRKIDLTVSTLRMSSRFVEE
DTVKKLVSNLPTQARVYVEDKMETMGDSKKKMTRNRSGGQALIRELLVGRPEQLMHARLE
ECRRGVVAQFDHALWLQLVDDQRHAHAVVERMHLLLLIFAHIGCRGVVAFLHNDLDTAGP
STTQRLLQLDSSRRLLGLWIVGMLSYDVIPQTAFCREACLTQGATHTVQNGDAFNRHPRL
RFCPKVDQRLLGLQRAQECHGCINIFLAAAHMVLFEQMMRHPASQDMAALRAHWRLKDGG
YKARNLVHENSRRGNAVLLIKLDHTFFRARPSRFLTIRRAGGRRSRY
Download sequence
Identical sequences A9VEB3
jgi|Monbr1|13108|fgenesh1_pg.scaffold_74000002 81824.JGI13108 XP_001751060.1.20067

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]