SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Monbr1|28133|fgenesh2_pg.scaffold_24000022 from Monosiga brevicollis

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Monbr1|28133|fgenesh2_pg.scaffold_24000022
Domain Number - Region: 96-160
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 0.00186
Family Phosphate binding protein-like 0.065
Further Details:      
 
Domain Number - Region: 108-262
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 0.0135
Family Phosphate binding protein-like 0.091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Monbr1|28133|fgenesh2_pg.scaffold_24000022
Sequence length 321
Sequence
MSTQKAAGHHELVAALPMYDLPGLANAHDVWYQAIRRAFAKVSSQASVPDTKELPAELCR
QPETLLEAASLNGHVLAPLYQTCGLPLVSGHRDIFRLVAVPHYDVDECRDGHYCSVIVAR
DDVRGNSPSDFHGCVAAVNGQDSLSGCIMLYAWLGAAAQHVRVVTTGAHASSLEHLRQRT
HGACLAAIDAVTLALLCQEQGADEVLRGLRIVGHSPTALALPYVTSAVLADRDPSLVPRL
QQALQQAAQDPDPAVVAARHRLHIARLEPAGPRFTFDTYRARILALERDIHAAWPPAPAA
DKGGSTSLDSPSTTTRWPVPP
Download sequence
Identical sequences A9V7A6
81824.JGI28133 XP_001748663.1.20067 jgi|Monbr1|28133|fgenesh2_pg.scaffold_24000022

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]