SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000004073 from Ochotona princeps 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000004073
Domain Number 1 Region: 2-130
Classification Level Classification E-value
Superfamily N-terminal domain of MutM-like DNA repair proteins 1.01e-28
Family N-terminal domain of MutM-like DNA repair proteins 0.00000053
Further Details:      
 
Domain Number 2 Region: 133-244
Classification Level Classification E-value
Superfamily S13-like H2TH domain 9.13e-27
Family Middle domain of MutM-like DNA repair proteins 0.00000217
Further Details:      
 
Domain Number 3 Region: 249-290
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.85e-18
Family C-terminal, Zn-finger domain of MutM-like DNA repair proteins 0.0000983
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000004073   Gene: ENSOPRG00000004417   Transcript: ENSOPRT00000004418
Sequence length 378
Comment pep:novel genescaffold:pika:GeneScaffold_2505:2330:5031:1 gene:ENSOPRG00000004417 transcript:ENSOPRT00000004418 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPEGPELQLASHFVNQACEGLVFGGRVEKSAVSRNPEVPFESSAYRISALARGKELRLWL
RPLPGAGPCQEPLALVFRFGMTGSFQLVPGDELPRHAHLRFYTAPPGPRLALCFVDVRRF
GHWELGGEWQPGRGPCVLLEYEQFRENVLRNLADKAFDRPICEALLDQRFFNGIGNYLRA
EILFRLRIPPFEQARTVLEALRQRRPSPELTLSQKIKAKLQNPDLLELCHLVPKEVVQLG
GKGYGPVNGEEDFAAFRAWLRCYGVPGMSSLQDRHGRTMWFQGDPGPLAPKGRKSRKKKL
QEPQPDPVYRTEDPPSPCKAPARKPRAKKHLSKMQPAAPTAAEEGSKRGQPAVSGRRKAR
KKAEPEPPPLEPEVVSAS
Download sequence
Identical sequences ENSOPRP00000004073 ENSOPRP00000004073

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]