SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000006106 from Ochotona princeps 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000006106
Domain Number 1 Region: 222-339
Classification Level Classification E-value
Superfamily Elongation factor Ts (EF-Ts), dimerisation domain 9.94e-24
Family Elongation factor Ts (EF-Ts), dimerisation domain 0.00000254
Further Details:      
 
Domain Number 2 Region: 99-228
Classification Level Classification E-value
Superfamily Elongation factor Ts (EF-Ts), dimerisation domain 4.25e-18
Family Elongation factor Ts (EF-Ts), dimerisation domain 0.00000589
Further Details:      
 
Domain Number 3 Region: 46-97
Classification Level Classification E-value
Superfamily UBA-like 0.000000000000169
Family TS-N domain 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000006106   Gene: ENSOPRG00000006670   Transcript: ENSOPRT00000006668
Sequence length 346
Comment pep:novel genescaffold:pika:GeneScaffold_4225:302206:316940:1 gene:ENSOPRG00000006670 transcript:ENSOPRT00000006668 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLLWSLRLGLVARTGSRAAGCSVFPAPQPRPTFHTGPLLSSSASSKELLMKLRRKTGYS
FVNCKKALETCGGDLKQAETWLQQQAQKEGWSKAAKLHGRKTREGLIGLLQEGNATVLVE
VNCETDFVSRNVKFQQLVQQVALGTMLHCQSQQDQLSTYRKXXXXXXXXXXXXXXXXXXX
XXGFLDSKALSGLPTGPDQEGFLKDQLALAIGKLGENMILKRAAWVKVPSGFYVGSYVHG
AIHSPSLHNLVLGKYGALVICETAEQPANLEDLGRHLGQHVVGMAPLSVGSLDDEPGGEA
ETKMLSQPYLLDPSITLGQYVQPQGVSIVDFVRFECGEGEEVAEAE
Download sequence
Identical sequences ENSOPRP00000006106 ENSOPRP00000006106

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]