SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000006764 from Ochotona princeps 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000006764
Domain Number 1 Region: 1-68
Classification Level Classification E-value
Superfamily Nucleoplasmin-like core domain 4.97e-23
Family Nucleoplasmin-like core domain 0.0000617
Further Details:      
 
Weak hits

Sequence:  ENSOPRP00000006764
Domain Number - Region: 188-270
Classification Level Classification E-value
Superfamily HRDC-like 0.0222
Family RNA polymerase II subunit RBP4 (RpoF) 0.017
Further Details:      
 
Domain Number - Region: 140-166
Classification Level Classification E-value
Superfamily ARM repeat 0.0489
Family GUN4-associated domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000006764   Gene: ENSOPRG00000007381   Transcript: ENSOPRT00000007383
Sequence length 274
Comment pep:novel genescaffold:pika:GeneScaffold_4464:950:9768:1 gene:ENSOPRG00000007381 transcript:ENSOPRT00000007383 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLK
MSVQPTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVEEDAESEDEEEEDVKLLTMSG
KRSAPGGGSKVPQKKVKLAADEDDDEDDEDDDDDEDDDDDDFDDEEAEEKAPVKKSVRDT
PAKNAQKSNQNGKDSKPSTPRSKGQESFKKQEKTPKTPKGPSSVEDIKAKMQASIEKGGS
LPKVEAKFVNYVKNCFRMTDQEAIQDLWQWRKSL
Download sequence
Identical sequences ENSOPRP00000006764 ENSOPRP00000006764

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]