SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000011483 from Ochotona princeps 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000011483
Domain Number 1 Region: 397-549
Classification Level Classification E-value
Superfamily ALDH-like 1.44e-34
Family ALDH-like 0.00013
Further Details:      
 
Domain Number 2 Region: 33-228
Classification Level Classification E-value
Superfamily ALDH-like 5.63e-25
Family ALDH-like 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000011483   Gene: ENSOPRG00000012577   Transcript: ENSOPRT00000012575
Sequence length 565
Comment pep:novel genescaffold:pika:GeneScaffold_4376:36032:59081:-1 gene:ENSOPRG00000012577 transcript:ENSOPRT00000012575 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLLLPLPTMRRVLLARPWRGAGLQWKHMYSLQVANEPILAFTRGSPERDAVQKALSALK
SQTEAIPCVVGDEEVWTSDVQYQLSPFNHRHKVAKFCYADKALLNKAIEASLAARKEWDL
KPVADRAQIFLKAADILSGPRRAEVLAKTIVGQGKTVIQAEIDAVAELTDFFRFNAKFAL
ELEGEQPISLPPSTNSVVYRGMEGFVAAISPFNFTAIGGNLAGAPALMXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTFKRLWKQV
ALNIDRYRTFPRLAGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSFGRIKKWLDHARSSPNLTILAG
GKCDDSVGYFVEPCIVESKNPQDPIMKEEIFGPVLTVYVYPDDKYKETLRLVDGTTSFGL
TGAVFAQDKKVIQEATEMLRHAAGNFYINDKSTGSVVGQQPFGGSRASGTNDKPGGPHYV
LRWTSPQVIKETHQPLGDWRYAYMQ
Download sequence
Identical sequences ENSOPRP00000011483 ENSOPRP00000011483

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]