SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000011719 from Ochotona princeps 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000011719
Domain Number 1 Region: 51-100
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), beta-barrel domain 2.43e-19
Family Transcription factor IIA (TFIIA), beta-barrel domain 0.0000854
Further Details:      
 
Domain Number 2 Region: 2-52
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 7.59e-18
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.0000867
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000011719   Gene: ENSOPRG00000012841   Transcript: ENSOPRT00000012831
Sequence length 108
Comment pep:novel scaffold:pika:scaffold_11704:41416:49561:-1 gene:ENSOPRG00000012841 transcript:ENSOPRT00000012831 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AYQLYRNTTLGNSLQESLDELIQSQQITPQLALQVLLQFDKAINSALAQRVRNRVNFRGS
LNTYRFCDNVWTFVLNDVEFREMTELIKVDKVKIVACDGKXXXXXXTE
Download sequence
Identical sequences ENSOPRP00000011719 ENSOPRP00000011719

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]