SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000013175 from Ochotona princeps 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000013175
Domain Number 1 Region: 175-358
Classification Level Classification E-value
Superfamily vWA-like 0.00000000645
Family Trunk domain of Sec23/24 0.05
Further Details:      
 
Domain Number 2 Region: 662-770
Classification Level Classification E-value
Superfamily Sensory domain-like 0.00000785
Family YkuI C-terminal domain-like 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000013175   Gene: ENSOPRG00000014411   Transcript: ENSOPRT00000014433
Sequence length 1222
Comment pep:novel genescaffold:pika:GeneScaffold_3284:39212:274170:1 gene:ENSOPRG00000014411 transcript:ENSOPRT00000014433 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRLAAEELGVVTMQRIFNSFVYTEKISNGESEVQQLAKKIREKFNRYLDVVNRNKQVVE
ASYTAHLTSPLTAIQDCCTIPPSMMEFDGNFNTNVSRTISCDRLSTTVNSRAFNPGRDLN
SVLADNLKSNPGIKWQYFSSEEGIFTVFPAHKFRCKGSYEHRSRPIYVSTVRPQSKHIVV
ILDHGASVTDTQLQIAKDAAQIILSAIDEHDKISVLTVADTVRTCSLDQCYKTFLSPATS
ETKRKMSTFVSSIKSSDSPTQHAVGFQKAFQLIRSTNNNTKFQANTDLAIVYLSAGITSK
DSSEEDKKATLRVINEENSFLNNSVMILTYALMNDGVTGLKELAFLRDLAEQNSGKYGVP
DRTSLPVIKGSMMVLNQLSNLETTVGRFYTNLPNRMIDEAVFSLPFSDEMGDGLIMTVSK
PCYFGNLLLGIVGVDVNLAYILEDVTYYQDSLASYTFLIDDKGYTLMHPSLTRPYLLSEP
PLHTDIIHYENIPKFELVRQNILSPLGSQIITVPVNSSLSWHINKLRETXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGQPSACLHFKQLATLES
PTVMLAAGSFSSPYEHLSQPEXXXXXXXXXXXXXXXXXXXXXXXXXFSVRNEVMATSHVT
DEWMTQMEMSSLNTYIVRRYIATPNGVLRIYPGSLMDKAFDPTRRQWYLHAVANPGLISL
TGPYLDVGGAGYVVTISHTIHSSSTQMSSGHTVAVMGIDFTLRYFYKVLMDLLPVCNQDG
GNKIRCFIMEDRGYLVAHPTLIDPKGHAPVEQQHITHKEPLVANDILNHPNFVKKNLCNS
FSDRTVQRFYKFNTSLVGDLTNLVHGSHCSKYRLARIPGTNAFVGIVNETCDSLAFCACS
MVDRLCLNCHRMEQNECECPCECPLEVNECTGNLTNAENRNPSCEVHQEPVTYIAIDPGL
QDALHQCVNSRCSQRMESGDCFGVLDCEWCMVGSDGKTHLDKSYCAPQKECFGGIVGAKS
PYVDDMGAIGDEVITLNMIKSAPVGPVAGGIMGCIMVLVLAVYAYRHQIHRRSHQHMSPL
AAQEMSVRMSNLENDRDERDDDSHEDRGIISNTRFIAAVIERHAHSPERRRRYWGRSGTE
SDHGYSTMSPQEDSENPPCNSDPLSAGVDVGNHDEDLDLDTPPQTAALLSHKFHHYRPHH
PSLHHSHHLQAAVTVHTVDAEC
Download sequence
Identical sequences ENSOPRP00000013175 ENSOPRP00000013175

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]