SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000014256 from Ochotona princeps 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000014256
Domain Number 1 Region: 164-511
Classification Level Classification E-value
Superfamily ALDH-like 2.88e-138
Family ALDH-like 0.0000000000054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000014256   Gene: ENSOPRG00000015596   Transcript: ENSOPRT00000015606
Sequence length 516
Comment pep:novel genescaffold:pika:GeneScaffold_2377:422832:528719:-1 gene:ENSOPRG00000015596 transcript:ENSOPRT00000015606 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSSIEMPGEVKADPAALMASLHLLPSPTPNLEIKYTKXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGDYFTFTRHEPIGVCG
QIIPWNFPLLMFAWKIAPALCCGNTVVIKPAEQTPLSALYMGALIKEAGFPPGVINILPG
YGPTAGAAIASHIGIDKIAFTGSTEVGKLIQEAAGRSNLKRVTLELGGKSPNIIFADADL
DYAVEQAHQGVFFNQGQCCTAGSRIFVEESIYEEFVRRSVERAKRRIVGSPFDPTTEQGP
QIDKKQYNKILELIQSVAEGAKLECGGKGLGRKGFFIEPTVFSNVTDDMRIAXXXIFGPV
QEILRFKTMDEVIERANNSDFGLVAAVFTNDINKALTVSSAMQAGTVWINCYNALNAQSP
FGGFKMSGNGREMGEFGLREYSEVKTVTVKIPQKNS
Download sequence
Identical sequences ENSOPRP00000014256 ENSOPRP00000014256

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]