SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000015661 from Ochotona princeps 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000015661
Domain Number 1 Region: 4-324
Classification Level Classification E-value
Superfamily ALDH-like 3.53e-80
Family ALDH-like 0.00000000476
Further Details:      
 
Domain Number 2 Region: 366-424
Classification Level Classification E-value
Superfamily ALDH-like 0.0000000000673
Family ALDH-like 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000015661   Gene: ENSOPRG00000017159   Transcript: ENSOPRT00000017158
Sequence length 504
Comment pep:novel genescaffold:pika:GeneScaffold_5171:193936:211087:1 gene:ENSOPRG00000017159 transcript:ENSOPRT00000017158 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MECEVQRVRQAFRSGRSRPLRFRLQQLEALRKMVQEREKDILGAIAADLCKXXXXXXXVK
EVNAILGEIDSMLRNLEWITAQVKKTFTMLDEAYIQAEPLGVVLIIGAWNYPFVLTMQPL
IGAIAAGNAVIVKPSELSENTTKVLSKLLPYLDQDLYTVINGGVQETTELLKQRFDHILY
TGNAAVGKIVMEAAAKHLTPVTLELGGKSPCYVDRDCDLDTVCRRITWGKYMNSGQTCIA
PDYILCEAQLQDQIVQKIKETVKEFYGENIKESPDYERIINLRHFKRIQSLLESKIAFGG
ETDEATRYIAPTVLTDVDPKSKVMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXLIKRMINETSSGGVVGNDVIMHFTLNSLPFGGVGYSGMGAYHGKHTFDTFSHQRS
CLLKSLKGEGANKLRYPPNSQSKVDWAKFFLLKQFNKGKLGLLLLTVLGILAAVLIKKYQ
AVLRRKALLVFLVVHSLRGSGKQW
Download sequence
Identical sequences ENSOPRP00000015661 ENSOPRP00000015661

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]