SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|58039257|ref|YP_191221.1| from Gluconobacter oxydans 621H

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|58039257|ref|YP_191221.1|
Domain Number 1 Region: 2-234
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 7.26e-37
Family Methylenetetrahydrofolate reductase 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|58039257|ref|YP_191221.1|
Sequence length 250
Comment 5,10-methylenetetrahydrofolate reductase [Gluconobacter oxydans 621H]
Sequence
MTRVSVELVPRSPEALLTDVQTVRDVLPQVRTLNVPDLMRFDLRSYDAASLVTKQAPFEV
IPHIRAVDIAPGAPLPGADRPELTSILVVAGDPPSAGSDWKVYPNTSAQIIERYRREAPH
LKVYAVFDPYRRAPYQELEDIARKRDAGACGFFTQPLFDIPMLEYCMDWLRDDTVFWGIS
PVLGDKSRRYWERVNHVVFPRDYDGTLEGNIAFARRMLDVIRGKNDNAYLMPLKVDLASY
LGALDDIITG
Download sequence
Identical sequences Q5FST1
gi|58039257|ref|YP_191221.1| 290633.GOX0791 WP_011252361.1.3606 WP_011252361.1.61435 WP_011252361.1.92951

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]