SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|58039691|ref|YP_191655.1| from Gluconobacter oxydans 621H

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|58039691|ref|YP_191655.1|
Domain Number 1 Region: 9-317
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 6.01e-62
Family beta-Lactamase/D-ala carboxypeptidase 0.0000000697
Further Details:      
 
Domain Number 2 Region: 427-525
Classification Level Classification E-value
Superfamily D-aminopeptidase, middle and C-terminal domains 8.37e-38
Family D-aminopeptidase, middle and C-terminal domains 0.00011
Further Details:      
 
Weak hits

Sequence:  gi|58039691|ref|YP_191655.1|
Domain Number - Region: 341-414
Classification Level Classification E-value
Superfamily D-aminopeptidase, middle and C-terminal domains 0.00254
Family D-aminopeptidase, middle and C-terminal domains 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|58039691|ref|YP_191655.1|
Sequence length 525
Comment D-aminopeptidase [Gluconobacter oxydans 621H]
Sequence
MSDSFSARLEAAVSALPARFPGPGGAVAVLKDGEVLVRHGWGYANVERRIPFTPSTLFRM
CSITKQFTCGTLLDLYDDPSELDADVDARLPQLDEPSPGMLHLAHNQSGLRDYWAVAMLH
GAPIEGYFGDREARRVIDGTRTLQFQPGTSYSYVNQNFRLISDILQDRTGRSFAELLQTS
IFNPVGMERAILAAETRAMPDGTVGYEGSVESGFRPAINNIWWTGDAGLGASLDDMIAWE
RFIDETRDAPDSLYRRLTVPVTFSDGQPAPYGFGLQRTKMFGRDVTMHGGALRGWRSHRL
HVASERLSVVVMFNHMSAAQVASAQILAAALGVPYEPERSTQQPTALYGTYLERETGLSA
RIEPAPGGAKLRYLMVPELLEGISATRAEAGSVVVKAQETAEGAEAVMERPGENRTSILA
RCDETPGEDIAELAGVYRCEELDEAEVTIELAGGVVYGGFSGILGDGRMEMLQRLAKDVW
VLPCPRALDHTAPGDWTLAFERQGGSVTAVRVGCWLARDLMYQRV
Download sequence
Identical sequences Q5FRJ7
290633.GOX1238 gi|58039691|ref|YP_191655.1| WP_011252791.1.3606 WP_011252791.1.61435 WP_011252791.1.92951

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]