SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|58040634|ref|YP_192598.1| from Gluconobacter oxydans 621H

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|58040634|ref|YP_192598.1|
Domain Number 1 Region: 27-302
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 3.92e-90
Family Methylenetetrahydrofolate reductase 0.000000133
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|58040634|ref|YP_192598.1|
Sequence length 309
Comment methylenetetrahydrofolate reductase [Gluconobacter oxydans 621H]
Sequence
MNTNLKRLLSGKLADHPSLCHSDMPVPVLSFEVVPPRTDAMEQRLWQCMRRLAPLSPRFV
SVTYGACGTMQAQTQATVLRLKQETTLVPAAHLTCIGATREEIDDIARTYWQAGVRHILA
LRGDAPAGTDYTPHPGGYAYAGDLVAGLRRIADFEISVAAYPETHPTAPNPQADIDNLKR
KFDAGASRAITQYFFEASTCLRFLDRCLAAGITAPIVPGIMPVSNYDHIARFSAFCGVTV
PVWLTHLFEGTAKNPELCRIAACIVAAEQVRTLQSHGINEFHFSTLNRPDLTCAIAHLLG
VRPASETDS
Download sequence
Identical sequences Q5FNV4
WP_011253715.1.61435 WP_011253715.1.92951 290633.GOX2207 gi|58040634|ref|YP_192598.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]