SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|39938540|ref|NP_950306.1| from Onion yellows phytoplasma OY-M

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|39938540|ref|NP_950306.1|
Domain Number 1 Region: 237-758
Classification Level Classification E-value
Superfamily PFL-like glycyl radical enzymes 2.75e-149
Family R1 subunit of ribonucleotide reductase, C-terminal domain 0.00000000477
Further Details:      
 
Domain Number 2 Region: 91-236
Classification Level Classification E-value
Superfamily R1 subunit of ribonucleotide reductase, N-terminal domain 1.05e-39
Family R1 subunit of ribonucleotide reductase, N-terminal domain 0.000052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|39938540|ref|NP_950306.1|
Sequence length 769
Comment ribonucleotide reductase alpha subunit [Onion yellows phytoplasma OY-M]
Sequence
MSGNKNWGKNYGKAGDTIASTYNVPLVLKFEGSGMPEERAFLKKWLACYCNDQKLPSYQS
QTQAQLQTLTPKKTVLPPWITLTNQIIDEQGNIKDLNKDKEALQSFLQEGVLPKLKRFAT
LQEKLTFLQENEYYESAFLQKYTHSQIKEIYQIAYQKNFTFPTFMGAFKFYHDYALKTRD
KQHYLETYEDRLSVNALYHAKGDFEIAKRLIVSLINQDFTPATPTLLNTGKKHRGEFVSC
FLLEAGDSLNDIARINEFSMQLSKIGGGVSINITNLRAKGESIKGIKGVCKGVVGVCKLL
DHSFRYADQIGLRTGAGAVYLNVFHSDIIDFLSTKKLSADEDVRVKTLSLGVVVPNKMIE
LARNNEVMYTFFPHTVFLEYGKNFADIAVDMDYWYDILVANPKVQKKAINPRQLLELIAH
MQGESGYPYLMFCDNTNQANTSDLKVKFSNLCTEILQPTITSHYKDYHQTQQDEIGMDVS
CNLASGHMGNMITNNTIQETVFMAMEVMNCVSENTNISYVPAVAKANFINRSVGFGIMGH
HGFLAQNYIAFGSEENKDLIDVFFNAVNFYSLLHSCNKAKTTGKKFYRFEQSKYADGSYF
DNRGEILPKTAKIKKMFQNITLPTQKDWHQLKQDVMQFGLYNSHRLAVAPNGSIGYIMGA
TPSLTPVKQLVEERTYGNSKTYCPMPALKQTSFMYTTAYKMNKYDLIDVIAIAQKHVDQG
ISFELGITSDITTRELQKYYLYAHHKKIKTLYYTRTQKLKIDECEACGV
Download sequence
Identical sequences Q6YRG1
gi|39938540|ref|NP_950306.1| 262768.PAM_054

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]