SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|39938575|ref|NP_950341.1| from Onion yellows phytoplasma OY-M

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|39938575|ref|NP_950341.1|
Domain Number 1 Region: 5-160
Classification Level Classification E-value
Superfamily Obg GTP-binding protein N-terminal domain 1.31e-43
Family Obg GTP-binding protein N-terminal domain 0.0000144
Further Details:      
 
Domain Number 2 Region: 155-332
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.74e-43
Family G proteins 0.0000057
Further Details:      
 
Domain Number 3 Region: 351-421
Classification Level Classification E-value
Superfamily Obg GTP-binding protein C-terminal domain 1.22e-20
Family Obg GTP-binding protein C-terminal domain 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|39938575|ref|NP_950341.1|
Sequence length 422
Comment hypothetical protein PAM_089 [Onion yellows phytoplasma OY-M]
Sequence
MFSLHFVDEAFNEVFAGNGGHGIVAFRREKYVAFGGPAGGNGGKGGSVIFVGDKDETTLL
KLKYQKHLKAPHGINGKNKGQNGANAPHLYVKVPLGTVFYTADNKFLGEILYDQQTLVIA
KGGKGGKGNKALATFKNQAPSYAEKGDLGESFKIKTELKVLADIGLLGFPSVGKSSLISA
ISKAQPKVASYPFTTIKPHLGVVEVDGFSFVVADLPGLIANAHLGCGMGIQFLKHIERCR
VLVHILSMESANPYQDFQTLNQELSQYNPQLLLKKQIIVTNKMDLPDALQKLTLLKQQIK
DQPIIPLSLVSFDNLETLKYEMSSLLQNTPLEVAPNKNNDFKLYTLPDNQNTISVIKESD
SVFVVSGKQVETFFHRTDFNNEEAVKRFNRILKKIGMEEQLQKQGAKPGDQVKICDRLFY
FL
Download sequence
Identical sequences Q6YRC6
gi|39938575|ref|NP_950341.1| 262768.PAM_089 WP_011160464.1.81900

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]