SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|39938925|ref|NP_950691.1| from Onion yellows phytoplasma OY-M

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|39938925|ref|NP_950691.1|
Domain Number 1 Region: 115-204
Classification Level Classification E-value
Superfamily Homing endonucleases 0.0000000000363
Family Intein endonuclease 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|39938925|ref|NP_950691.1|
Sequence length 356
Comment hypothetical protein PAM_439 [Onion yellows phytoplasma OY-M]
Sequence
MPMSFNIKIKEEIACQKFLPIENFFELTALLHFGCELEKNHQKTLLWFQTKSIKIARRFL
ILIKTFYPNTNSFLMTSKEYNLPHLKSIHVGIEKDIPLILEKHHFFTQTPSDFLPLLKSQ
KAKKAFLRGIFLCIGFVNDPKKTNYHLEFFHKDRHKIELIKTLMLHFSLNAKKINHKKGF
LVYLKESQMIIDFLRLIGALEIVFQYEKTIIQKDLNHIIKSSINFEISNEKKILTSANLQ
LQQINLIEKHFQIPNLKPKNTNLKMKNPKNEKSQKQLPNLEPKLLQIMLLRKENPDASLQ
ELTQKYYHKHKQQITKSGLNYYFQKIKKLACEIETPQILAPSKEKNKYGKYRHRFS
Download sequence
Identical sequences Q6YQD5
gi|39938925|ref|NP_950691.1| 262768.PAM_439

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]