SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|39939151|ref|NP_950917.1| from Onion yellows phytoplasma OY-M

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|39939151|ref|NP_950917.1|
Domain Number 1 Region: 6-206
Classification Level Classification E-value
Superfamily DhaL-like 1.06e-40
Family DhaL-like 0.0047
Further Details:      
 
Weak hits

Sequence:  gi|39939151|ref|NP_950917.1|
Domain Number - Region: 371-430
Classification Level Classification E-value
Superfamily post-AAA+ oligomerization domain-like 0.0578
Family DNA polymerase III clamp loader subunits, C-terminal domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|39939151|ref|NP_950917.1|
Sequence length 571
Comment hypothetical protein PAM_665 [Onion yellows phytoplasma OY-M]
Sequence
MNKDKVIQFIDGQLFKNMITNGAINLQNNYQTIDNLNVFPVPDRDTGTNMKITMMSGVKE
ISNLETRSIVEVSQVLSKALLMGAKGNSGVILSQFFAGMAQTYQKLNKETININDFIHSL
EGGYQKAYQAIIEPQEGTILTVFREAVKQTLKAKSQFSTIEDVLSNFLQNAQKTLSQTTE
LLEVLKQAGVVDSGGAGFVEILKGMLLFLQDQKLLQVNQNTQTHTNPDKIQTLGQVNIKY
TYCTEYIFQIKASQEKNLDMKQLKQALLQIGDSLVLVKDQEILKIHIHTNKPGQVLEKLL
TYGTLKVSKIDNMKEQHQSILDQKHDTFTLQQEPTPDPKSPSNLPNSNKDQKYFFIAFVN
DTKSQKVFADLKVNHIIKQSTFNPTTFEKLLQTNTSQNIIILPNDTSLLEKLTTQLKQLQ
GTNQEIVLLQTKNIAQGYSALLAFDKSLDLVQNKTIMEETIKNIQTGKIIYADKKDAKNI
SNQTLLEKEYLSVWEEKIIATNKDKYRALKTLLQKMIKPHQTFLTVFYNPSCTDEKELEK
LETFLETNYDHIELETLESQNNNIPYIVSLE
Download sequence
Identical sequences Q6YPR0
gi|39939151|ref|NP_950917.1| 262768.PAM_665 WP_011161009.1.81900

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]