SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|39939226|ref|NP_950992.1| from Onion yellows phytoplasma OY-M

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|39939226|ref|NP_950992.1|
Domain Number 1 Region: 6-80,171-351
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.12e-60
Family Bacterial dinuclear zinc exopeptidases 0.00000267
Further Details:      
 
Domain Number 2 Region: 70-179
Classification Level Classification E-value
Superfamily Aminopeptidase/glucanase lid domain 2.14e-29
Family Aminopeptidase/glucanase lid domain 0.0000964
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|39939226|ref|NP_950992.1|
Sequence length 354
Comment endo-1,4-beta-glucanase [Onion yellows phytoplasma OY-M]
Sequence
MKMSDLVSLLKDLTMLNGIPGQEKAVANYVVDKIKNQVDSIEYDNLGSVIACKGKTGPRI
MFAGHLDEIGLIVKQITPEGFIKFQTLGGWFSQVMLAQVWQIHTDKGVLKAVTGCKPPHV
MSFQERNQVINTSSMYLDIGVANKEEALKLGVRVGDMVTPYIEFSTLGNSDYLLAKALDN
RVGVAIVMQVLENVNPTTNQFFGVFTTQEEVGLRGAQTSAHKVHPQIAIAVDTGIGNDVP
GGEKEGHTLGKGPQVLVYDGGLVAHKGLRNFVLKIAAQNNIPVQEISGSGGRTDAATMHL
VREGAASLSFGVPVRYIHSHTSVVHKQDIINTVKLLTLLVNQLDEKKVNEILFQ
Download sequence
Identical sequences Q6YPI7
262768.PAM_740 gi|39939226|ref|NP_950992.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]