SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Ost9901_3|15846|fgenesh1_pg.C_Chr_6000233 from Ostreococcus lucimarinus CCE9901

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Ost9901_3|15846|fgenesh1_pg.C_Chr_6000233
Domain Number 1 Region: 3-216
Classification Level Classification E-value
Superfamily Hsp33 domain 4.05e-51
Family Hsp33 domain 0.0000104
Further Details:      
 
Domain Number 2 Region: 238-284
Classification Level Classification E-value
Superfamily HSP33 redox switch-like 0.000000000811
Family HSP33 redox switch-like 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Ost9901_3|15846|fgenesh1_pg.C_Chr_6000233
Sequence length 291
Sequence
MSANQEVAVIAVVGTSLVRDAATRHRTAPTATAALGRSLMCALLLGTFKGEDETTQLTFK
GDGPLGQIVAVATHDGRAKGFCSNPNADPPLRSDGKLNVGAAVGRGVLTVSRAHPSMKTP
FSGSVAIRTGEIAEDVAGYLSESEQVGSAIAVGVAIDRECEVIAAGGFMVQILPFASDET
IEILERIIPSLPSSTALVQEGLTAEQIAQRVLGELGEQKDLITRMTPEYGPCEPTELRGR
MLRAVASLGKEEVAKILAEDGQIEITCEFCKVTSVLKEADLAKAQGEVDAR
Download sequence
Identical sequences A4RZ51
436017.A4RZ51 XP_001418269.1.19716 jgi|Ost9901_3|15846|fgenesh1_pg.C_Chr_6000233

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]