SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Ost9901_3|39859|e_gwEuk.1.96.1 from Ostreococcus lucimarinus CCE9901

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Ost9901_3|39859|e_gwEuk.1.96.1
Domain Number 1 Region: 527-695
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 6.95e-66
Family Polyphosphate kinase C-terminal domain 0.0000484
Further Details:      
 
Domain Number 2 Region: 129-317
Classification Level Classification E-value
Superfamily PHP14-like 9.61e-51
Family PPK middle domain-like 0.00077
Further Details:      
 
Domain Number 3 Region: 348-524
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 1.04e-50
Family Polyphosphate kinase C-terminal domain 0.0000214
Further Details:      
 
Domain Number 4 Region: 20-127
Classification Level Classification E-value
Superfamily PPK N-terminal domain-like 1.2e-28
Family PPK N-terminal domain-like 0.0007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Ost9901_3|39859|e_gwEuk.1.96.1
Sequence length 813
Sequence
MEEDKDALSEYDVETLVKSDPVFNAEMSWLAFNWRVLAMAANEEVPIFERLRFVAISARN
LDEFFAKRVGAIKRQAAAGLENLVKQRGREVWTPQETLQNVAAEVERQVDAQAALLEDHI
VPALKAHNIYLEQYDDLSKDLRTKLGDYFEAQIEPVLDPRAIDPCHPFPFLGSLSLSIAV
ELEDAFKQEKFAIVSVPAALERWIRVGDSKDSSEQRFLPLEQLIEANMEKLFRGCNIRDT
HVFRVTRNADIERNEDEAEDLLEMMADEVRERRFASFVRLEVQDTMPEYIRDKLIDSLDG
ITLTDVITVPHRAPLGFGTIDSLPVNFGMDIEMLYPPWSPRTHPRLEQIRGSEGTIFSAI
SEGDILVHHPYVSFATSTQAFIEEAARDPDVLSIKSTLYRTSDNSPIVRALIKAAENGKQ
VAVLVELKARFDEARNVGFAQRLETAGCNVAYGVKGVKTHSKASLVVRREGKKLVKYVHI
GTGNYNPSTAGIYTDFGLLSRDDQLGDDVSNLFKFLMGHHYQERFNKLIVAPLRMQNEFV
EMIEREAENALKGKPASIIAKMNGLDDAVICAALYRASQAGVKIHLIIRGICRVRPGIPG
VSENIRVVSIVGRFLEHHRVFRFENNGSPEFYMGSADLMRRNLLRRVEVITRVYDPKIQT
ELQEVLDACLTDQVLAWEMGSDGRYYRTPTSRQVAANHLAHDPGKGRLMKMAATDGLHVA
LMADTLKMMKRSDKRANLATLATKKVKKVERAPKEVRARVLKTNAPEVNDKTDVIEQQVQ
AKAPENTRPKFEDVISVEEGVIMRSVEDSADES
Download sequence
Identical sequences A4RQI1
jgi|Ost9901_3|39859|e_gwEuk.1.96.1 XP_001415736.1.19716 436017.A4RQI1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]