SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|46445820|ref|YP_007185.1| from Candidatus Protochlamydia amoebophila UWE25

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|46445820|ref|YP_007185.1|
Domain Number - Region: 109-139
Classification Level Classification E-value
Superfamily TTHA1013/TTHA0281-like 0.0994
Family TTHA0281-like 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|46445820|ref|YP_007185.1|
Sequence length 349
Comment polysaccharide export protein wza [Candidatus Protochlamydia amoebophila UWE25]
Sequence
MMKYLAFCLLSLLFFLSSCSTPCHNYDVFGADEFVIDSYKIRQGKLAILDMEGSDVKELD
CDAMEEYQDVISEDDILNIAIYHPKRRDVMDAIQFINATIGFRVSEGRVDFPDIPSVEVA
GLSLEEARQKIQLCYQEQIQDVEVFLNYRNRLSRKVELTGAVATPVIAVDGKIRLYEVLA
LAKVPNNANFFKSYVVREGKQLPIDIYKLMNLGDMSQNIVMRGGDRIFIAAPSDSTVMVM
GEVGHPMAVNLPYGFMSLRQALVSAGGIPFTGNRDCIQVIRGNLQNPKIYVLSWNHIIHL
PNDSLLLMPGDTVYVSEKPITQWNRFIDQLLPSCLGVQAAYGTYRLFRN
Download sequence
Identical sequences A0A0C1K3Y3 Q6MET9
gi|46445820|ref|YP_007185.1| 264201.pc0186

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]