SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|46445970|ref|YP_007335.1| from Candidatus Protochlamydia amoebophila UWE25

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|46445970|ref|YP_007335.1|
Domain Number 1 Region: 360-600
Classification Level Classification E-value
Superfamily RNI-like 4.71e-57
Family Cyclin A/CDK2-associated p19, Skp2 0.011
Further Details:      
 
Domain Number 2 Region: 251-396
Classification Level Classification E-value
Superfamily L domain-like 0.000000000000952
Family Internalin LRR domain 0.044
Further Details:      
 
Domain Number 3 Region: 142-215
Classification Level Classification E-value
Superfamily POZ domain 0.0000000863
Family BTB/POZ domain 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|46445970|ref|YP_007335.1|
Sequence length 602
Comment hypothetical protein pc0336 [Candidatus Protochlamydia amoebophila UWE25]
Sequence
MHIYNTRFNPSNFIANTNIHTYYRSNNRLKFSERISLLCKKIFQSSLHPFFTYINRDQFQ
SQWREIFWGRKEIVISKRTRTQETFDNPKDENKLLVTSLAAIEEIGTSTIQPSNPLPFPQ
EEFKLSFQDETSLIIPSSQLSLLMEKSPYFKSLWSGNFQETLRDPLTLTQKEFIHLLNCL
MDANFKVSEEDIPSFIQLADYYQLTEVVKNLGEQLLDIYKSKKFELFNSSEDSLVELKEV
LNFARQYQLNTLKNYLELTVVSSLLNQTSQLTEFEKILKHFSNEIERLDFLENDYLTDTH
LLVLKNCKNLKELYLQRCHNLTDAGLAHLAPLLALQHLDLSECNNLTDAGLAHLTPLMAL
QHLNLSYCKNLTDAGLAHLTPLVALQYLDLSGCDNLTDAGLAHLTPLMALQHLGLSACDK
LTDAGLAHLTPLVALQYLSLNGCDKLTDVGLAHLTPLVALTHLNLSWCDKLTDAGLAHLT
PLVALQHLNLRWCRKLTDAGLAHLTPLVALQHLDLNRCPKLTDAGLAHLTSLVNLRHLNL
SYCRKLTDVGLAHLTPLVALQHLNLSCCRKLTDAGLAHLASLLALQHLDLSGCDKLTDAV
LE
Download sequence
Identical sequences Q6MED9
gi|46445970|ref|YP_007335.1| 264201.pc0336

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]