SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|46446003|ref|YP_007368.1| from Candidatus Protochlamydia amoebophila UWE25

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|46446003|ref|YP_007368.1|
Domain Number 1 Region: 203-397
Classification Level Classification E-value
Superfamily PheT/TilS domain 1.78e-70
Family B3/B4 domain of PheRS, PheT 0.00000736
Further Details:      
 
Domain Number 2 Region: 472-696
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.49e-42
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00043
Further Details:      
 
Domain Number 3 Region: 43-195
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 6.28e-37
Family Myf domain 0.0052
Further Details:      
 
Domain Number 4 Region: 704-799
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 1.44e-20
Family Anticodon-binding domain of PheRS 0.0018
Further Details:      
 
Domain Number 5 Region: 409-480
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 4.39e-19
Family Domains B1 and B5 of PheRS-beta, PheT 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|46446003|ref|YP_007368.1|
Sequence length 802
Comment phenylalanine-tRNA ligase subunit beta [Candidatus Protochlamydia amoebophila UWE25]
Sequence
MVIMRIPLSWLKEYIDLNLEPVEIAKILTMAGLEVDGYEEIGKGFSGVIVGDVLEVEKHP
NADKLLIALVSDGKEIHQVVCGASNCRKGLKTAFAPVGASLIDEGKEFKIKKGKLRGIES
NGMLCSAKELQISNEDDGIMELSEHLQAGTALNTLYSDTIFEISLTPNLGHCASIVGVAR
ELSAATSHPLRYPHLVFKEEGNLINNSLTLDIEAKEACSRYTCRVIKNVKVGASPDWLKA
KIEKSGLRSVNNIVDVTNYVLLEMGHPLHAFDYDLVKGKKIVVRMAQEGEIFETLDGKER
ILKDSHLVIADSEKPIAIAGVMGGRNSEVSEKTTNIILESAFFDPIFVRKTSKQLGLQTD
ASKRFERGTDPNQLISVLNRAAMLIQMVAGGIIEDSILDEQTKDFLELTIRCRLSRINQI
LGTTLSRGEVETIFQSLGFHYQWDGQDSFMVCVPTYRTDVKEEIDLIEEVARIYGYDHIP
RNGGRYQTSKLPDAPIYLFEKEIQSYLIAEGLQEFITCDLIGPTLVNVVQNLSMPAEAIV
KVLNPTSIEQSILRTSLLPGLLQVVKYNLDHQNHQINGFEIGRIHFKDGDQYQEQSVVGI
LLSGFSQPYHFEEKKREYDFYDLKGIIENLLKELGIEKPQFKNLDLKTFHSGRQASLFVD
ELEVGSFGEVHPSIQRRLDVSQRILFGEFNLHDLMQVATKLEKVKPLAIYPGSERDWTFT
IKTSVPFAEIIKAIHEQKSDLLENVLLLDIYRSEKLTVGHQNMTLRFIYRDFSKTIAQEV
VENEHQRLKTAVSQKFANDLKQ
Download sequence
Identical sequences 264201.pc0369 gi|46446003|ref|YP_007368.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]