SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|46446273|ref|YP_007638.1| from Candidatus Protochlamydia amoebophila UWE25

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|46446273|ref|YP_007638.1|
Domain Number 1 Region: 23-224
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 1.13e-44
Family PP-loop ATPase 0.00097
Further Details:      
 
Domain Number 2 Region: 359-431
Classification Level Classification E-value
Superfamily PheT/TilS domain 0.000034
Family tRNA-Ile-lysidine synthetase, TilS, C-terminal domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|46446273|ref|YP_007638.1|
Sequence length 458
Comment hypothetical protein pc0639 [Candidatus Protochlamydia amoebophila UWE25]
Sequence
MSCICLKNEKLNVINQVKRFIKKYCKSTQPLLLALSGGADSLSLFYCLLACRLEGILSFH
VAHVDHGWREESAKEATILKNLAEQHQVPYHQLKIDLSQLAGNLEDACRKQRQKFFKEIC
LQNNLQAVCLGHQENDQVETVLKRILEGSHWSHFDGLKERMWHDQVQFLRPLLGIQKDEI
LAFLKGNQLKAFEDGTNCDERFMRARMRRTIIPDLNRSFGKKIDNSLVYIASEMSELKNF
FLGRVSPLLGQIVKGPFGVYLNLANHPSIDLVEIKYLLRLISEQELFFLSRQILQRASEA
IEKLEPQLSFEMGTKKIVIDRGHFFILSKKTACKNPNLQISGSSLQYYGKWMIKTNESFY
HQNLQASTWLDGWRGYLKTYLPLDKYVLGQASKHAKLLRHHSTINKWWSSHHVPPFLRSF
FPVIWQHNEIAHEFLTGLERQNLQEGEKCLQIELSYLT
Download sequence
Identical sequences Q6MDI6
gi|46446273|ref|YP_007638.1| WP_011175189.1.90613 264201.pc0639

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]