SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|46446308|ref|YP_007673.1| from Candidatus Protochlamydia amoebophila UWE25

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|46446308|ref|YP_007673.1|
Domain Number 1 Region: 700-888
Classification Level Classification E-value
Superfamily RNI-like 0.000000000895
Family 28-residue LRR 0.031
Further Details:      
 
Domain Number 2 Region: 429-614
Classification Level Classification E-value
Superfamily RNI-like 0.0000463
Family Cyclin A/CDK2-associated p19, Skp2 0.066
Further Details:      
 
Weak hits

Sequence:  gi|46446308|ref|YP_007673.1|
Domain Number - Region: 966-990,1030-1087
Classification Level Classification E-value
Superfamily POZ domain 0.0557
Family BTB/POZ domain 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|46446308|ref|YP_007673.1|
Sequence length 1154
Comment hypothetical protein pc0674 [Candidatus Protochlamydia amoebophila UWE25]
Sequence
MSISLQNIHQQFNEALKSNLYIGIKENKITKTNKKEIPLSQIYAIASAQICIHATNLENI
NHLQLLLCDGEKLYARYCSHTNTWKRWFLKKLEHYSPAIFKFIFPCLFANGIEAAEKQTQ
QAHEKYHSELNNRISILKTLPHPPPAPSQILLPSSRLTGSPTQVTPSSPNPISPNSSSKL
LQTSTPFHTKTSTNNELETEHLPQETTRIPSSEINELSKKTKKLAHDAKVKGEKCLDVDQ
SQKSIERIKTYLSKLSLETKESLESLKGANHSQFMQSLKKICKDFVRLTFFKELKPYKNS
FITETGISLEVFELILKLKTLFFQGSTIDLTGTVLADDWKASNEFLKFGLQKLGNIQNYV
FTDTSDRKIPERQVFQKPQHIKFDNKQLNYFKQFLESHADYTPLSLEIRCEFECFTFDTF
KDLLMLKERIPSISLTDLEILDFNKMNLSEEQEKYVIENLSQFSLPHLKSLTLKLHKKAS
IEAKYFSQLLQLCPTLDVMRQCLFASQQPKDIDIPCTILSQSYVDLTGYPLELVHHLLPQ
FIYLEQLTLDQNDFTTLDLEKIYREGLLNSLHTFVLHNGKLSTDALFFLTKLNSLKILSL
PPLSLGSYSLSQLPTFTDPQAIIRFYANQPLTRPYAMALYTGLPLAATTFQIVLAQGGES
HVFAPNHLILDPESVVLWLHDNHYTHLQPQASVQSIIADNVGELNDSNLVSFVEKFPNVK
ELSLRNCPSLTGTGIRALITECPQIEKIDLCGCLGINIQFLENSHYLIANSQLIIDISDT
GISADDVWIYTQFLSKNLIFEKLSLKIRDEDLKNKTLEQILNENQPLHHLNRIDLEGCTT
LTDKDLSQLLARLNVDQKQLDEYHCLVDNPQRLNISILNLKGCTQITEKAFDDEILAGKI
KPKILNSLNQIVVGKTKLENCSLLRTIYPKVIFQTEFTSITIQVDPSQPNINTENFTLLF
QTDDQAEGISFQTSKNLLTTQSSYFRKVLHGENEGTTLIHQCATVEAVTVLIDLFKCRSF
KEDLDWKVAGQVAELVRPECLDFPAIYFHKLINHIHSQFSLDNATDMFFLAEKLNDEKGK
KLFEEKLIAIAKQCEETKLSILSQLAQTYSLQKLEKFLNQQALSLIESVNMSTDQEELER
LSLDLAIQLSRVEI
Download sequence
Identical sequences Q6MDF1
gi|46446308|ref|YP_007673.1| 264201.pc0674 WP_011175224.1.90613

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]