SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|46446522|ref|YP_007887.1| from Candidatus Protochlamydia amoebophila UWE25

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|46446522|ref|YP_007887.1|
Domain Number 1 Region: 208-497
Classification Level Classification E-value
Superfamily RNI-like 9.94e-48
Family Cyclin A/CDK2-associated p19, Skp2 0.08
Further Details:      
 
Domain Number 2 Region: 423-645
Classification Level Classification E-value
Superfamily RNI-like 3.77e-37
Family Cyclin A/CDK2-associated p19, Skp2 0.024
Further Details:      
 
Domain Number 3 Region: 82-157
Classification Level Classification E-value
Superfamily POZ domain 0.00000526
Family BTB/POZ domain 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|46446522|ref|YP_007887.1|
Sequence length 653
Comment hypothetical protein pc0888 [Candidatus Protochlamydia amoebophila UWE25]
Sequence
MNIPTLSYSYLVNTMTTSDYQSQEISDLSRDEDIPLGNSLANIEETSAPTIQVHDFSSSS
EELQLSFQEGTSLTISHSQLAMLREKSLYFKTLWSGNFQETLQHPLALTQKEFTHLLNCV
MDANFKVPLEEITSSIQLADYYELTEVVKNLEEQLIEGYRTQEFEPFSSTEESLVALKEL
LNFAHRYQLSTLKNYLELTVVSALLNQTSQLTEFEKIIKHFLNEIEAFNFSDNAYLTDAH
LLALKDCKNLKVLHLEKCQVITDDGLAHLTPLTALQHLELSDCRKLTDAGLAHLTPLTAL
QHLNLSFCDKLTDAGLAHLTPLTALQHLNLSRCYYKLTDAGLAHLTPLTALQHLNLSFCD
KLTDAGLVHLKLLTGLQHLDLREFWELTGAGLAHLTTLTALQHLDLSGCDKLTDVGLAHL
TPLTTLQHLDLKRCRNLTNAGLVHLKLLTGLQHLNLSECYHLTDAGLAHLTPLTALQHLD
LSQCSKLTDDGLAHLTPLTALQHLDLSQCSKLTDDGLAHLTPLTALQHLVLARCRNLTDA
GLAHLTPLETLQHLNLSGGYKLTGAGLAHLRPLVALQHLDLSYCNGLTDAGLAHLTPLVA
LQHLDLSYCDGLTDAGLTHLRPLVALQHLDLSYCDGLTDAGLAHFKFLAAIIH
Download sequence
Identical sequences Q6MCT7
WP_011175438.1.90613 264201.pc0888 gi|46446522|ref|YP_007887.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]