SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|46446659|ref|YP_008024.1| from Candidatus Protochlamydia amoebophila UWE25

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|46446659|ref|YP_008024.1|
Domain Number 1 Region: 345-588
Classification Level Classification E-value
Superfamily RNI-like 1.7e-55
Family 28-residue LRR 0.027
Further Details:      
 
Domain Number 2 Region: 569-669
Classification Level Classification E-value
Superfamily RNI-like 1.57e-21
Family 28-residue LRR 0.07
Further Details:      
 
Domain Number 3 Region: 223-409
Classification Level Classification E-value
Superfamily L domain-like 6.21e-21
Family Internalin LRR domain 0.0089
Further Details:      
 
Domain Number 4 Region: 84-159
Classification Level Classification E-value
Superfamily POZ domain 0.00000494
Family BTB/POZ domain 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|46446659|ref|YP_008024.1|
Sequence length 695
Comment hypothetical protein pc1025 [Candidatus Protochlamydia amoebophila UWE25]
Sequence
MNISNTGFNSSYLVNTTNPSYYPLQDINDQLENENTPLDNPLPNLEETSASTIQPSALSP
SSEEVQLSFQEGTSLTISYSQLALLREKSRYFNNLWSGQFQETLQHPLALTQKEFTHLLN
CVMDANFKVPLEEITSTIHLADYYELTEVIKHLEAQLISGYRSQRFEPFNSTEESLVGLK
ELLNFAHRYQLNRLKNYLEFTVVSALLNQTSQLAEFERIINHFSKKIEGLNFSNNRYLTD
AHLLILKNCKNLKVLHLEKCRALTDDGLAHLTPLTALQYLNLSASYNLTDAGLVHLAPLT
ALQKLNLGRYNQLTDAGLAHLKPLTALQRLDLSFCEDLTDDGLAHLRPLTALQRLDLRYC
EKLTDDGLVHLRPLTALQRLNLSNCWHTGAGLSHLSPLTGLQHLNLYECINLTDAGLVHL
KLLTGLQHLNLSYCDELTDAGLVHLKLLTGLQHLNLSNCNNLTDAGLVHLKFLTGLQHLN
LSYCDELTDAGLVHLKLLTGLQHLNLSNCNNLTDAGLAHLTPLTGLQHLDLSYCSKLTDD
GLAHLKPLTALQCLNLSNCRNLTDAGLVHLKLLTGLQHLNLSDYKNLTDDGLIHLMPLMA
LRHLELLGCENLTDAGLVHLTPLTALQHLNLSHCDDLTDAGLAHLTSLTGLQHLELLGCE
NLTDAGLARFKTVANSLYLIIKRFFVLRESRIKFH
Download sequence
Identical sequences Q6MCF0
gi|46446659|ref|YP_008024.1| 264201.pc1025 WP_011175575.1.90613

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]