SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|46446667|ref|YP_008032.1| from Candidatus Protochlamydia amoebophila UWE25

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|46446667|ref|YP_008032.1|
Domain Number 1 Region: 348-541
Classification Level Classification E-value
Superfamily RNI-like 1.44e-48
Family 28-residue LRR 0.059
Further Details:      
 
Domain Number 2 Region: 519-641
Classification Level Classification E-value
Superfamily RNI-like 1.26e-28
Family 28-residue LRR 0.015
Further Details:      
 
Domain Number 3 Region: 227-410
Classification Level Classification E-value
Superfamily L domain-like 1.47e-27
Family Internalin LRR domain 0.016
Further Details:      
 
Domain Number 4 Region: 84-159
Classification Level Classification E-value
Superfamily POZ domain 0.0000022
Family BTB/POZ domain 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|46446667|ref|YP_008032.1|
Sequence length 662
Comment hypothetical protein pc1033 [Candidatus Protochlamydia amoebophila UWE25]
Sequence
MNISNFGLNSSYLVNTTNPSYYPLQDINDQLENENTPLDNPLPNLEETSASTIQPSTLSP
SSEEVQLSFHEGTSLTISPSQLALLREKSLYFKTLWSGNFQETLQHPLDLTKKDFTLLLN
FLMDANFKVPLEEIISAIQLTDYYELTEVVKNLEKQLMEEYKSQRFEPFNSTEESLVRLK
EILSFAQRCQLNTLKNYLEFTVVSELLNKAFLSDEFGRIINHFSNEIKILNLPNKILNNA
CFLALKSCENLKVLHFKECRHLTDAGLAHLTPLTALQHLGLGQCWRLTNAGLAHLTPLTA
LQYLNLSEYKNLTDAGLAHLTPLTALQHLGLSGCQNLTDAGLAHLTPLMGLQHLDLSGCQ
NLTDAGLAHLTPLTGLQHLNLSRCNKLTDAGLAHLTPLTGLQHLDLSGCQNLTDAGLAHL
TPLTGLQHLDLSGCQNLTDAGLAHLTPLTGLQHLNLCNCRKFTDNGLAHLTPLSVLQHLN
LSRCNKLTDVGLAHLTPLTALQHLDLSSCYNLTDVGLAHLTPLTSLQHLGLISCDKLTDA
GLVHLKLLTGLQHLNLSNCKNLTDAGLAHLTPLTALQYLYLNWCRKLTDAGLAHLTSLTA
LQHLDLRYCQNLTDAGLAHLTPLTGLRHLDLSQCWRLTKAGLARFKTLAASLNLEIRLGS
FP
Download sequence
Identical sequences Q6MCE2
gi|46446667|ref|YP_008032.1| WP_011175583.1.90613 264201.pc1033

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]