SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|46446912|ref|YP_008277.1| from Candidatus Protochlamydia amoebophila UWE25

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|46446912|ref|YP_008277.1|
Domain Number 1 Region: 418-658
Classification Level Classification E-value
Superfamily RNI-like 4.97e-54
Family 28-residue LRR 0.012
Further Details:      
 
Domain Number 2 Region: 307-414
Classification Level Classification E-value
Superfamily RNI-like 9.42e-19
Family Rna1p (RanGAP1), N-terminal domain 0.058
Further Details:      
 
Domain Number 3 Region: 181-256
Classification Level Classification E-value
Superfamily POZ domain 0.00000361
Family BTB/POZ domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|46446912|ref|YP_008277.1|
Sequence length 731
Comment hypothetical protein pc1278 [Candidatus Protochlamydia amoebophila UWE25]
Sequence
MNIHNPSVKPSNLLVNADTHSYFRSNNYLKFSERIGLLCKTIFQGFLNLFFNYLEKEQLQ
SQWREISGGRKEITIPKFIASRLASSDISLTSSSQILCDAPPFSIRTPTQETIDKFEDEN
ELLLNSLANPEELNVLKNTSPKKIKSSTTPQSSDLFSSSQEFKLRFQDETSLNISYSQLA
LLREKSPYFKSLWSGNFRETLQNPLALTQTEFTHLLDCLEYSISFVPLEDILSFIQLADY
YQLSEAGKKLEKQLIEAYKSQKLEPFNSTTDSLVELKALLNFAQQYQLNTLKNYLELIVV
SSLLNQASHVTEFEKILKHFSNEIERLNFSKNASLTDAHLLALKNCKNLKALHLQECYKL
TDTGLVYLAPLVSLQYLNLFDCIKLTDAGLAHLTPLVALRHLNLMGCNKLTNAGLMHLRP
LMALQHLDLSCCRNLTDAGLAHLAPLVALQHLCLSECTNLTGAGLAHLKPLVNLQHLNLN
SCYKLTDAGLAHLTPLMALQHLDLSCCRNLTDAGLAHLRPLVALQHLDLNCCKNFTDAGL
THLTPLVALQHLNLSCCRNLTDAGLAYLMPLVALSHLNLAGCHNFTDAGLAHLAPLVALQ
HLNLGDCYRLTNAGLEHLTPLVALQHLDLSECEKLTDAGLTHLVPLVALTHLDLSECDKL
TDAGLAHLTPLEALQHLNLNWCDKLTDAGLAHLTPLLALQDLYLGYCKNFTEVGLAHFKS
SVAPLHLKIIR
Download sequence
Identical sequences Q6MBP7
gi|46446912|ref|YP_008277.1| WP_011175827.1.90613 264201.pc1278

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]