SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|46447087|ref|YP_008452.1| from Candidatus Protochlamydia amoebophila UWE25

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|46447087|ref|YP_008452.1|
Domain Number 1 Region: 1-73
Classification Level Classification E-value
Superfamily TTHA1013/TTHA0281-like 0.000000000000144
Family TTHA0281-like 0.089
Further Details:      
 
Domain Number 2 Region: 69-106
Classification Level Classification E-value
Superfamily Ribbon-helix-helix 0.0000000334
Family Omega transcriptional repressor 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|46447087|ref|YP_008452.1|
Sequence length 107
Comment hypothetical protein pc1453 [Candidatus Protochlamydia amoebophila UWE25]
Sequence
MLKYKNYTGFVQFDDEAMIFHGEVLGLRDVITFRGTTPEEIKKEFEISIDGYLDWCKELG
QEPEKPFSGNIHLRLQPDLHAKLAAEAKFNGISLNNYISQTLKQAIQ
Download sequence
Identical sequences Q6MB72
WP_011176002.1.90613 264201.pc1453 gi|46447087|ref|YP_008452.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]