SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|46447096|ref|YP_008461.1| from Candidatus Protochlamydia amoebophila UWE25

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|46447096|ref|YP_008461.1|
Domain Number 1 Region: 543-863
Classification Level Classification E-value
Superfamily RNI-like 1.6e-49
Family Cyclin A/CDK2-associated p19, Skp2 0.051
Further Details:      
 
Domain Number 2 Region: 318-648
Classification Level Classification E-value
Superfamily RNI-like 2.51e-45
Family Cyclin A/CDK2-associated p19, Skp2 0.012
Further Details:      
 
Domain Number 3 Region: 193-268
Classification Level Classification E-value
Superfamily POZ domain 0.00000416
Family BTB/POZ domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|46447096|ref|YP_008461.1|
Sequence length 870
Comment hypothetical protein pc1462 [Candidatus Protochlamydia amoebophila UWE25]
Sequence
MYHLKMIQLIRVVILNIQNIRSNLSHFIVNTDTHFYIRSNDHLKFSERIVLLCKTIFQCF
LNLFFNYLKKDQLQSQWREVFWGQKEFVISNLAPTQSESGTFLSSPSQISDFALPFITAN
RNQETINYPKNENNLVIDSFNNSIDSNISNSHFPKTVDPLIIPPSQLSPSPQGVKLSFQG
GTSLTIPYSQLALLRKKSPYFKSLWSGHFQETLQGPLAITEKKFTNLLQCLMDANFKLSV
EDIPCSIALAHYYQLTDVVENLEKQLIKIYQSEEDALFNSNEESLIELKELLNFARLYQL
NNLINYLEFTVVSGLLNNTSHVNEFEKILNHFSTDIEELNLSGKDFFTEAHFLALKNCKN
LKVLCLKIFYTPIDTGLAHLTSLTALQNLDLSECYLLKDTGLAHLSSLTALQYLDLSGCD
DLTDAGLAHLTPLVSLQHLDLSKCENLTGDGLAHLTPLVALRHLGLSDCRNLTDAGLAHL
TPLTALKHLDLSECKNLTDDGLVHLSSLVALQYLSLKLCENLTDAGLAHLTSLTALEHLD
LGLDFGYCQNLTDDGLAHLSSLTALKHLDLSWRENLTDAGLAHLTSLTALKHLDLSWCEN
LTDEGLAYLTPLVALQYLSLKGSDITDEGLEHLAHLSALRHLSLNDCRRIYHGYGLAHLT
TLVNLEHLDLSGCYSLSSFKLIFLSSLVNLQHLNLSGCFGLYHDGLEDLTPLMNLQYLDL
SSCINLTDKGLAYLTSLVGLGLQHLDLSGCKEITDTGLAHLTSLVGLEYLDLSWCENLTD
KGLAYLTSFAGLKYLNLKGCKKITDAGLAHLTSLVTLQRLNLSECVNLTDTGLAHLVSLV
NLQDLELRECKSITDTGLAHYIQNQQIIYR
Download sequence
Identical sequences Q6MB63
WP_011176010.1.90613 gi|46447096|ref|YP_008461.1| 264201.pc1462

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]