SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|46447141|ref|YP_008506.1| from Candidatus Protochlamydia amoebophila UWE25

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|46447141|ref|YP_008506.1|
Domain Number 1 Region: 412-623
Classification Level Classification E-value
Superfamily RNI-like 1.8e-47
Family 28-residue LRR 0.093
Further Details:      
 
Domain Number 2 Region: 230-509
Classification Level Classification E-value
Superfamily RNI-like 7.85e-43
Family Cyclin A/CDK2-associated p19, Skp2 0.032
Further Details:      
 
Domain Number 3 Region: 122-199
Classification Level Classification E-value
Superfamily POZ domain 0.0000000785
Family BTB/POZ domain 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|46447141|ref|YP_008506.1|
Sequence length 623
Comment hypothetical protein pc1507 [Candidatus Protochlamydia amoebophila UWE25]
Sequence
MNIHNPSFNPSNLLVNADTHSYSRSNKHLKFFERINLLCKTIFQGFSSLFFNYLKKDLLQ
FQWRKLLGEQKEIVISNFTITHLESESDVSLSSLSQTSYFAPPSSRLSFQDNTHLNISSF
QKSLLMEKSPYFKSLWSGSFQETLQDPLALTQKEFTHLLYSLINANFKFPFEDIPSFIQL
ADYYQLTEVVKNLEEQLLNGYKSEKFKFFNSNEDSLVELKELLNFAQQYQLDTLKNYLEL
TAVSSLLNQTSQLTEFEKILNYFSNEVEALNFSENAHLTDAHLLALKTCKNLKVLYLKKC
CNLTDAGLSHLSPLVALQHLELSDCPRLTDAGLAHLTSLVALQYLNLSECSNFTDAGLAH
LTPLLTLTHLNLSWCYNFTHAGLAHLTPLVALQHLNLGHCRNITDAGLAHLSPLVALQHL
NLGWCSNLTDAGLAHLSPLVALQHLDLGWCSNLTDAGLAHLTSLVALQHLDLSWCYYLTD
AGLAHLSPLVALQHLDLSNCLSLKDAGLAHLTLLVTLKYLNLNKCHNLTDAGLAHLTPLV
ALQHLDLSQCPNLTGTGLAHLNSLMALQHLDMSWCHNLTDAGLTHLTPLVNLRHLNLTKC
PKLTDAGLAHLAPLVALEHLDLS
Download sequence
Identical sequences Q6MB18
gi|46447141|ref|YP_008506.1| WP_011176053.1.90613 264201.pc1507

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]