SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|46447144|ref|YP_008509.1| from Candidatus Protochlamydia amoebophila UWE25

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|46447144|ref|YP_008509.1|
Domain Number 1 Region: 285-579
Classification Level Classification E-value
Superfamily RNI-like 1.26e-50
Family 28-residue LRR 0.0066
Further Details:      
 
Domain Number 2 Region: 582-667
Classification Level Classification E-value
Superfamily RNI-like 5.65e-19
Family 28-residue LRR 0.01
Further Details:      
 
Domain Number 3 Region: 126-200
Classification Level Classification E-value
Superfamily POZ domain 0.0000000251
Family BTB/POZ domain 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|46447144|ref|YP_008509.1|
Sequence length 670
Comment hypothetical protein pc1510 [Candidatus Protochlamydia amoebophila UWE25]
Sequence
MHIHNSNFHQPTPIVKPDTHSYSRSNKRLNFFERINLLCKTIFQGFSSLFFNYLKKDLAQ
FQWKGVLWRQKEIVISNSITYLETESDVSLSRSSLSQTSDFVFPSSRLSFQDGTFLIISN
FQISLLREKSPYFKNLWSGNFQETLQDPLTLTQKEFAYLLNCLVDASFKIPVEDILSFIQ
LADYYQLTEVVKNLEEQLLNGYKSEKFKLFNSNEDSLVELKELLNFAQQYQLDTLKNYLE
LTVVGSLLNQTSQLTEFEKILNYFSNEVEALNFSENAHLTDAHLLALKTCKNLKVLYLKK
CCNLTDAGLPHLTPLVALQYLDLSKCHNLTDAGLTHLTFLDALNYLGLGECYNLTDTGLA
HLKSLINLQHLNLNNCNFTDAGLAHLTPLVTLKYLNLSQCYNLTDAGLAHLTPLVNLQQL
NLSDCTNLTDTGLAYLSPLVTLQHLNLNVCKLIDAGLAHLTPLVNLQQLNLSYCTNLTDA
GLAHLSTLVTLQHLDLDGCYKLTDIGLAHLTPLVTLKYLNLSCCHNLTGAGLAHLTPLVA
LKHLDLSWNGDLEDAGLAHLTPLVALKYLDLSECYHLTDAGLAHLRSLVALKHLDLRGCY
QLTDAGIAHLTPLVALKYLDLKGCPNLTDAGLAHLTSLIALQDLELPNCQRITDAGLAHL
ASSMTLRIWT
Download sequence
Identical sequences Q6MB15
264201.pc1510 gi|46447144|ref|YP_008509.1| WP_011176056.1.90613

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]