SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|46447199|ref|YP_008564.1| from Candidatus Protochlamydia amoebophila UWE25

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|46447199|ref|YP_008564.1|
Domain Number 1 Region: 204-454
Classification Level Classification E-value
Superfamily RNI-like 1.14e-50
Family 28-residue LRR 0.062
Further Details:      
 
Domain Number 2 Region: 755-970
Classification Level Classification E-value
Superfamily RNI-like 2.16e-47
Family Cyclin A/CDK2-associated p19, Skp2 0.062
Further Details:      
 
Domain Number 3 Region: 905-1117
Classification Level Classification E-value
Superfamily RNI-like 2.35e-46
Family 28-residue LRR 0.048
Further Details:      
 
Domain Number 4 Region: 409-534
Classification Level Classification E-value
Superfamily L domain-like 0.0000000136
Family Internalin LRR domain 0.091
Further Details:      
 
Domain Number 5 Region: 608-684
Classification Level Classification E-value
Superfamily POZ domain 0.00000424
Family BTB/POZ domain 0.03
Further Details:      
 
Weak hits

Sequence:  gi|46447199|ref|YP_008564.1|
Domain Number - Region: 37-119
Classification Level Classification E-value
Superfamily POZ domain 0.000573
Family BTB/POZ domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|46447199|ref|YP_008564.1|
Sequence length 1143
Comment hypothetical protein pc1565 [Candidatus Protochlamydia amoebophila UWE25]
Sequence
MTPSTTQLPNHLTSSQEFELEFQDGTSITIPHSQLALLREKSPYLKSLWSENFLKNLWSK
ESEEFFQGPLTQKNFTNLLNCLLDANFKVPVEEILSSIHLAYYFQMTEVVKNLEEQLING
YKSQELELLSCIEDNLDELISILNFAHQRQLNILKNYLECAAVSVLLNQISELTEFEEFL
NLFSNEIEGGIESLDFSNNAYLTDAHLLALKDCKNLKVLRLHECRNFTDAGLAHLSRLVA
LQHLDLGGCYKITDSGLTYLSRLVALQHLNLNCCVCLTDDGLAYLSHLVALQHLDLGECY
KITDSGLAHLSSLLALQHLNLGCCNNLTDSGLAHLSHLTSLKHLDLRDCAKLTDSGLAHL
SLLVNLQYLNLNRCYNLTDRGLSHLSHLVALQYLDLGLCKKLTSSGLAHLSPLVALQYLD
LDRCGEITDRGLAHLSRLVALQHLNLNCCACLTDDGLAYLSPLVALRHLNLRCCGNLTSA
GLAHLTPLIALQYLNLSYCDSLNDNGLTHLTRLASLKHLDLSECPYFTDSGLAHFTALAT
SLTHFYCWSQVGSEHLEDESNIPVNPLAGLEEVAPSTTQLPNHLTSSQEFELIFQDETSL
TIPHSQLILLMEKSPYFKSLWSGGFPESLQNPLALTQKNFTNLLNCLLDANFKVPLEEIL
SSIHLAYYFQMTEVVKNLEEQLINGYKSQELELLSCIEDNLDELIFVLNFARKRQLNILK
NYLECAAVSVLLNQISELTEFEEFLNLFSNEIEGGIESLDFSNNAYLTDAHLLALKDCKN
LKVLRLHECRNFTDAGLAHLSPLVALQHLDLGGCYKITDSGLAHLSRLVALQHLDLGGCY
EITDSGLTYLSRLVALQHLNLNRCVCLTDDGLAYLSHLVALQYLDLDRCWKITDRGLAHL
SSLLALQHLNLGCCNNLTDSGLAHLSHLTSLKHLDLRDCAKLTDSGLAHLSLLVNLQYLN
LNRCNNLTDRGLAHLSHLVALQHLDLGECYKITDSGLAHLSLLVNLQYLNLNRCDNLTDR
GLAHLSRLVTLQHLNLNCCVCLTDDGLAYLSPLVALRHLNLRSCDNLTSAGLAHLTPLIA
LQYLNLSYCDSLNDNGLTHLTRLASLKHLDLSECPYFTISGLAHFKALAASLNLKIIRQK
DFQ
Download sequence
Identical sequences Q6MAW0
264201.pc1565 gi|46447199|ref|YP_008564.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]