SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|46447466|ref|YP_008831.1| from Candidatus Protochlamydia amoebophila UWE25

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|46447466|ref|YP_008831.1|
Domain Number 1 Region: 186-452
Classification Level Classification E-value
Superfamily RNI-like 4.19e-40
Family Cyclin A/CDK2-associated p19, Skp2 0.026
Further Details:      
 
Domain Number 2 Region: 82-157
Classification Level Classification E-value
Superfamily POZ domain 0.00000073
Family BTB/POZ domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|46447466|ref|YP_008831.1|
Sequence length 456
Comment hypothetical protein pc1832 [Candidatus Protochlamydia amoebophila UWE25]
Sequence
MNISNLSYSYPVNATAPSDYQSQEVSDPPRDEVNSLANSLDNLEKTSAPTIQVPDLSSSS
EELQLSFQEGTSLTISRSQLAMLREKSLYFKTLWSGNFQETLQHPLALTQKNFTLLLNCL
TDANVKVPLEEIPSFIQLADYYELTEVVKNLEEQLIDGYKSQRLEPFSSTKESLVGLKEL
LNFAQQYRLNPLKNYLELNVVSALLNQSSQLTEFEEILKYFSNEIEALNFSNNADLTDAH
LLALKNCKNLKVLDLQECWNFTDAGLAHLTPLTALQHLDLTGCFRVTDTGLAHLSPLVAL
QHLNLIGCDLTDAGLVHLKPLIALKHLDLMRCWNLTDAGLAHLRPLVALQHLNLTNCENI
TDVGLAHLTPLVALKHLDLMQCWKLTGNGLARLRSLVALQHLNLSGCSYLTDAGLAHLRP
LVALQHLDLANCYELTDAGLAHFKFLAATTHLDLRW
Download sequence
Identical sequences Q6MA43
264201.pc1832 gi|46447466|ref|YP_008831.1| WP_011176377.1.90613

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]