SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|46447549|ref|YP_008914.1| from Candidatus Protochlamydia amoebophila UWE25

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|46447549|ref|YP_008914.1|
Domain Number 1 Region: 233-522,594-650
Classification Level Classification E-value
Superfamily RNI-like 2.01e-54
Family Cyclin A/CDK2-associated p19, Skp2 0.042
Further Details:      
 
Domain Number 2 Region: 83-158
Classification Level Classification E-value
Superfamily POZ domain 0.0000000785
Family BTB/POZ domain 0.039
Further Details:      
 
Weak hits

Sequence:  gi|46447549|ref|YP_008914.1|
Domain Number - Region: 522-565
Classification Level Classification E-value
Superfamily L domain-like 0.00122
Family Internalin LRR domain 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|46447549|ref|YP_008914.1|
Sequence length 683
Comment hypothetical protein pc1915 [Candidatus Protochlamydia amoebophila UWE25]
Sequence
MNISNFGFNPSQFANITSPSYSPPQDINDHLENENTSLDKPLLNLEETTSTIQSSALSPS
SEEIQLSFQEGTSLTISHSLLTFLREKSPYFKNLWSGHFQETLQHPLDLTKKDFTLLLNC
LMDANFKVPLEEITSAIQLADYYELTEVVTNLEEQLIEGHKSQRFESFNSTEESLVGLKG
ILNFAQQCQLNALKNYLELTTVSALLNQTSQLTEFEKILNHFSNEIERVNFSENAHLTDA
HLLVLKNCKNLKVLYLQGCRNLTDAGLAHLTPLTGLQHLNLSWCRNLTDAGLAHLAPLTA
LQYLDLSHCRNLTDTGLAHLTPLTALQHLDLRVCKNITDAGLAHLAPLTALQNLDLSDCG
HLTDAGLAYLTPLTALQHLNLYFCFNLTDAGLVHLRPLTALQTLGLSQCWNLTDTGLAHL
TPLTALQHLNLSRCYKLTDAGLAHLTPLTALQHLNLSYCENLTDDGLAHLAPLTALQYLR
LSQCWKLTDAGLAHLTPLTALQHLNLSRCYKLTDAGLARLTPLTALQHLDLKYCINLTDA
GLARLTPLSGLQHLALTNCKYLTDAGLAHLTLLTALQYLALANCKNLTDVGLAHLTPLTA
LQHLDLSECRHLTDAGLAHLTPLTGLQHLNLSWCRNLTDAGLAHLSPLSVLQHLALSQCS
RLTDDGLDRFKTLATSLNLEIVR
Download sequence
Identical sequences Q6M9W0
WP_011176460.1.90613 264201.pc1915 gi|46447549|ref|YP_008914.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]