SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|46447653|ref|YP_009018.1| from Candidatus Protochlamydia amoebophila UWE25

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|46447653|ref|YP_009018.1|
Domain Number 1 Region: 494-763
Classification Level Classification E-value
Superfamily RNI-like 3.85e-42
Family 28-residue LRR 0.0069
Further Details:      
 
Domain Number 2 Region: 669-946
Classification Level Classification E-value
Superfamily RNI-like 1.02e-40
Family Cyclin A/CDK2-associated p19, Skp2 0.048
Further Details:      
 
Domain Number 3 Region: 279-559
Classification Level Classification E-value
Superfamily RNI-like 1.45e-35
Family 28-residue LRR 0.022
Further Details:      
 
Domain Number 4 Region: 176-250
Classification Level Classification E-value
Superfamily POZ domain 0.000000541
Family BTB/POZ domain 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|46447653|ref|YP_009018.1|
Sequence length 959
Comment hypothetical protein pc2019 [Candidatus Protochlamydia amoebophila UWE25]
Sequence
MNIQKAKSNPGHSIVNTDTHSYSQSNNPLKFFERISLLCKTIFQCFLNLFFNCITRDQLQ
SQWREVFWGQKEIIISNFTTTHSAKSEMPLLSSSQTPFLTESQNRESSDYPEDESNLIIN
SLDIPTNLNTSNKPFLEEINATTIHSSDFLSLPQEFKLSFQDETSLTIPNSQLTLLKEKS
PYFKSLWSGNFQETLREPLTLTQKEFTHLLDCLLIVDFKVSIEDILTFIQLADYYQLAEV
VKNLEQQLIDTYKSEKCELFNSTADSLIELKALLNFAQQYQLNNLKNYLELTVVSSLLNQ
ASHLTEFEKILKCFSNEIERLNFSKNASLTDAHLLALKDCKKLKVLYLQECNNLTDVGLA
YLRPLITLQGLNLNSCKKFTDAGLAHLDSLIDLTQLGLAKCHNITDNGLAYLRPLIALQG
LNLNGCKKLTDAGLVHLKSLVTLTYLNLSQCDDLTDAGLAHLTPLVALQHLDLSFCCYNI
TDAGLAHLTPLVALQNLDLSFCYKLTDDGLAHLKPLVALKQLNLWACSNLTGAGLAHLTP
LIALKHLDLGFCYGLTDDGLAHLKPLVALQYLSLSGCKKLTDAGLAHLTSLITLQQLNIS
SCANLTDDGLAHLKPLIALQQLNLSSCKKLTGVGLAHLTSLVNLTHLSLSECGNLTDAGL
AHLAPLVALQQLDLNFCYNLTDAGLAHLITLVALQQLYLSACGNLTDAGLAHLTPLVALQ
QLNLSGCKKLTGVGLAHLTSLATLTHLSLSACANLTDDGLAHLTTLVALTYLNLSDCNNF
TGAGLTHLKPLVALQYLSLSGCKKLTDAGLAYLKPLVALQQLNLRGCKKITDAGLTHLMS
LVALQCLSLSGCKKLTDDGLAHLKPLVALTHLSLGECVKLTDDGLAHLTPLLALTHLNLS
DCNNLTVAGLAHLTPLENLTYVDLNNCNNFTDVTLTYLTSLLTVQHFNRTWEECYFKLN
Download sequence
Identical sequences Q6M9K6
WP_011176562.1.90613 gi|46447653|ref|YP_009018.1| 264201.pc2019

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]