SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Carubv10002566m|PACid:20908147 from Capsella rubella v183

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Carubv10002566m|PACid:20908147
Domain Number 1 Region: 14-115
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000000255
Family B3 DNA binding domain 0.0065
Further Details:      
 
Domain Number 2 Region: 174-264
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000153
Family B3 DNA binding domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Carubv10002566m|PACid:20908147
Sequence length 276
Sequence
MLPKSVVDKLQENVSKPCFWKSLSPGQNWKSKSMRIIPEKIVGSTPGAFEHRVVFSVRWE
NSWQLWLERDKDDLFMQEEDWNEFVDDNHLGPNDTLFFRHDDTMDFEVQIFKNNGYEIMD
VPLEVELETEPLHHKPQNSHKETVTVSASGSENGGTNGRVRHRRDVMNPMRYLLNPENPH
FVKVVTKRNDVLYMSRPVIHRYRLKFGPLHSTIDFLLPGGQKEEGILRFYNGQPCFSGWS
VVCRKYKLNVGDYVVCEIERSGSLVTGVRVHFVNED
Download sequence
Identical sequences R0FJ18
Carubv10002566m|PACid:20908147 XP_006289143.1.15642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]