SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Carubv10002752m|PACid:20907569 from Capsella rubella v183

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Carubv10002752m|PACid:20907569
Domain Number 1 Region: 93-286,407-454
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.21e-65
Family Tandem AAA-ATPase domain 0.00000145
Further Details:      
 
Domain Number 2 Region: 750-971
Classification Level Classification E-value
Superfamily Helical scaffold and wing domains of SecA 2.75e-61
Family Helical scaffold and wing domains of SecA 0.0000333
Further Details:      
 
Domain Number 3 Region: 455-564,653-744
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.73e-49
Family Tandem AAA-ATPase domain 0.0000119
Further Details:      
 
Domain Number 4 Region: 285-407
Classification Level Classification E-value
Superfamily Pre-protein crosslinking domain of SecA 7.46e-44
Family Pre-protein crosslinking domain of SecA 0.0000293
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Carubv10002752m|PACid:20907569
Sequence length 997
Sequence
MVSLLCDSQLLNHRPSISSPTASQFVIADGIVLRQSRLLNSSSFWGTKFGNTVKLGVSGC
SSCSRRKSTSVNASLSGLLSGIFKGSDNGESTRQQYASTVASVNRLETEISALSDSELRG
RTDALKQRAQKGESMDSLLPEAFAVVREASRRVLGLRPFDVQLIGGMVLHKGEIAEMRTG
EGKTLVAILPAYLNALSGKGVHVVTVNDYLARRDCEWVGQVPRFLGLKVGLIQQNMTPEQ
RKENYLCDITYSVEELVLRDFNFCVIDEVDSILVDEARTPLIISGPAEKPSDQYYKAAKI
ASAFERDIHYTVDEKQKTVLLTEQGYEDAEEILDVKDLYDPREQWASYVLNAIKAKELFL
RDVNYIIRAKEVLIVDEFTGRVMQGRRWSDGLHQAVEAKEGLPIQNESITLASISYQNFF
LQFPKLCGMTGTASTESAEFESIYKLKVTIVPTNKPMIRKDESDVVFKAVNGKWRAVVVE
ISRMHKTGRAVLVGTTSVEQSDELSQLLREAGIAHEVLNAKPENVEREAEIVAQSGRLGA
VTIATNMAGRGTDIILGGNAEFMARLKLREILMPRVVKPTDGVFVSVKKAPPKRTWKVNE
KLFPCKLSDEKVKLAEEAVQSAVEAWGQKSLTELEAEERLSYSCEKGPVQDEVIGKLRNA
FLAIAKEYKGYTDEERKKVVEAGGLHVVGTERHESRRIDNQLRGRSGRQGDPGSSRFFLS
LEDNIFRIFGGDRIQGMMRAFRVEDLPIESKMLTKALDEAQRKVENYFFDIRKQLFEFDE
VLNSQRDRVYTERRRALVSDSLEPLIIEYAELTMDDILEANIGPDTPKESWDLEKLIAKV
QQYCYLLNDLTPDLLKSQGSTYEELQDYLRARGRDAYLQKREIVEKQSPGLMKDAERYLI
LSNIDRLWKEHLQALKFVQQAVGLRGYAQRDPLIEYKLEGYNLFLEMMAQIRRNVIYSIY
QFQPVRVKKDEEKKSQNGKPSKQVDNVSEKPSSIASA
Download sequence
Identical sequences R0FJB0
XP_006289283.1.15642 Carubv10002752m|PACid:20907569

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]